Result : EXP00665
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00665 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 3872765 |
| Right | 3872941 |
| Strand | + |
| Nucleotide Sequence | TTGGTAGAGCCCTGGATTGTGATTCCAGTTGTCGTGGGTTCGAATCCCATTAGCCACCCCATTATTAGAAGTTGTGACAATGCGAAGGTGGCGGAATTGGTAGACGCGCTAGCTTCAGGTGTTAGTGTCCTTACGGACGTGGGGGTTCAAGTCCCCCCCCTCGCACCACGACTTTAA |
| Sequence | LVEPWIVIPVVVGSNPISHPIIRSCDNAKVAELVDALASGVSVLTDVGVQVPPLAPRL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4312666 | 4312842 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 2792430 | 2792606 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 3 | 3991088 | 3991264 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3982525 | 3982701 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 3951677 | 3951865 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 4776057 | 4776233 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 4776283 | 4776459 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 4364217 | 4364393 | - | NZ_LR134340.1 | Escherichia marmotae |
| 9 | 4389264 | 4389452 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 10 | 100654 | 100833 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 11 | 340846 | 341016 | + | NZ_CP006569.1 | Sodalis praecaptivus |
| 12 | 3645650 | 3645829 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 13 | 1575243 | 1575425 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 14 | 1865953 | 1866132 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 15 | 3607352 | 3607552 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 16 | 4041411 | 4041599 | - | NZ_LS483422.1 | Providencia heimbachae |
| 17 | 992934 | 993107 | + | NC_006512.1 | Idiomarina loihiensis L2TR |
| 18 | 28675 | 28845 | + | NZ_CP013979.1 | Agromyces aureus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01943.19 | 0.81 | 13 | 4997 | same-strand | Polysaccharide biosynthesis protein |
| 2 | PF07429.13 | 0.88 | 14 | 3920.5 | same-strand | 4-alpha-L-fucosyltransferase glycosyl transferase group 56 |
| 3 | PF06899.13 | 0.88 | 14 | 2572.0 | same-strand | WzyE protein, O-antigen assembly polymerase |
| 4 | PF03808.15 | 0.88 | 14 | 1828.5 | same-strand | Glycosyl transferase WecG/TagA/CpsF family |
| 5 | PF04375.16 | 0.75 | 12 | 4365.0 | opposite-strand | HemX, putative uroporphyrinogen-III C-methyltransferase |
| 6 | PF07219.15 | 0.75 | 12 | 3166.0 | opposite-strand | HemY protein N-terminus |
| 7 | PF07719.19 | 0.69 | 11 | 3752 | opposite-strand | Tetratricopeptide repeat |
| 8 | PF02602.17 | 0.62 | 10 | 4494.0 | opposite-strand | Uroporphyrinogen-III synthase HemD |
++ More..