Protein Information |
Information Type | Description |
---|---|
Protein name | NAD(P)H-quinone oxidoreductase subunit L (EC 7.1.1.-) (NAD(P)H dehydrogenase I subunit L) (NDH-1 subunit L) (NDH-L) |
NCBI Accession ID | CP000806.1 |
Organism | Crocosphaera subtropica (strain ATCC 51142 / BH68) (Cyanothece sp. (strain ATCC 51142)) |
Left | 2165375 |
Right | 2165632 |
Strand | + |
Nucleotide Sequence | ATGGATACAATTATTGATGCGATCGCTTCGCTGCCTCAAGATACCCTAATTGTTGCTGTGTTGTATTTGGGGTTAAGTCTTCTCTATCTCTTGATCATCCCTGGATTTGTCTATTTTTATCTCAATAGTCGTTGGTATGTGGCCAGTTCCTTTGAACGAGCCTTTATGTACTTTCTGATGTTCTTTTTCTTCCCTGGGGTTCTCCTGTTAAGTCCGTTTCTTAACTTTCGTCCCAAACGCCGTCAAGTTAATTCTTGA |
Sequence | MDTIIDAIASLPQDTLIVAVLYLGLSLLYLLIIPGFVYFYLNSRWYVASSFERAFMYFLMFFFFPGVLLLSPFLNFRPKRRQVNS |
Source of smORF | Swiss-Prot |
Function | NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration. {ECO:0000255|HAMAP-Rule:MF_01355}. |
Pubmed ID | 18812508 |
Domain | CDD:402381 |
Functional Category | Others |
Uniprot ID | B1WNP9 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5265986 | 5266213 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
2 | 2617765 | 2618007 | - | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
3 | 2511648 | 2511899 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
4 | 2284591 | 2284818 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
5 | 2399269 | 2399499 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
6 | 724917 | 725147 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
7 | 4628891 | 4629130 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
8 | 8222480 | 8222692 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
9 | 3154059 | 3154271 | + | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
10 | 3849321 | 3849533 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
11 | 1904572 | 1904787 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
12 | 4823241 | 4823453 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
13 | 7139182 | 7139397 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
14 | 2261043 | 2261255 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
15 | 1050627 | 1050839 | + | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
16 | 6365083 | 6365295 | + | NZ_CP031941.1 | Nostoc sphaeroides |
17 | 4759986 | 4760198 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
18 | 3927198 | 3927410 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
19 | 1153646 | 1153858 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
20 | 3606286 | 3606516 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
21 | 1139382 | 1139612 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
22 | 5055493 | 5055702 | + | NC_014248.1 | 'Nostoc azollae' 0708 |
23 | 4663781 | 4663990 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00290.22 | 0.78 | 18 | 481.5 | same-strand | Tryptophan synthase alpha chain |
2 | PF11460.10 | 1.0 | 23 | 25 | same-strand | Protein of unknown function (DUF3007) |