Result : EXP00663
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00663 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 741445 |
| Right | 741543 |
| Strand | + |
| Nucleotide Sequence | ATCACGAGGTTCATGTTGATGAAAGGCTGCGAGAGAGGGCGCTGGTGCCGCTCAATCGTATGCTGGATTTTGCGGCTACACTACGTGGATAACGAATAA |
| Sequence | ITRFMLMKGCERGRWCRSIVCWILRLHYVDNE |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 866920 | 867000 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 783055 | 783135 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 2959739 | 2959819 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 575038 | 575118 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 1398188 | 1398268 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 1427080 | 1427160 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 2216238 | 2216321 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 307851 | 307934 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 9 | 1469342 | 1469425 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 10 | 1590453 | 1590536 | - | NZ_CP016337.1 | Kosakonia sacchari |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06519.13 | 0.78 | 7 | 4819.0 | same-strand | TolA C-terminal |
| 2 | PF07676.14 | 0.89 | 8 | 3455 | same-strand | WD40-like Beta Propeller Repeat |
| 3 | PF04052.15 | 0.89 | 8 | 3455 | same-strand | TolB amino-terminal domain |
| 4 | PF00691.22 | 1.0 | 9 | 2902.5 | same-strand | OmpA family |
| 5 | PF13174.8 | 1.0 | 9 | 2103.0 | same-strand | Tetratricopeptide repeat |
| 6 | PF16331.7 | 1.0 | 9 | 2103.0 | same-strand | TolA binding protein trimerisation |
| 7 | PF13432.8 | 1.0 | 9 | 2103.0 | same-strand | Tetratricopeptide repeat |
| 8 | PF02445.18 | 1.0 | 9 | -74.5 | same-strand | Quinolinate synthetase A protein |
| 9 | PF04973.14 | 1.0 | 9 | 32.0 | same-strand | Nicotinamide mononucleotide transporter |
| 10 | PF01545.23 | 1.0 | 9 | 747.5 | opposite-strand | Cation efflux family |
| 11 | PF13985.8 | 0.89 | 8 | 1802 | opposite-strand | YbgS-like protein |
| 12 | PF00793.22 | 0.89 | 8 | 2498 | same-strand | DAHP synthetase I family |
++ More..