Result : EXP00662
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00662 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1967670 |
| Right | 1967783 |
| Strand | + |
| Nucleotide Sequence | ATGGCACTTTTCGGTCAGACTCATATTCTGCACGATTGCGCGACAACGGCTCATGAACTTCCAGCCAGTTCGAGCCATCTGGTTCAGTGGTGTATTTTACTGGCTGGTCGATAA |
| Sequence | MALFGQTHILHDCATTAHELPASSSHLVQWCILLAGR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2062522 | 2062635 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1584467 | 1584580 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 2079862 | 2079975 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2732128 | 2732241 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 1047664 | 1047783 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 6 | 2610930 | 2611043 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01554.20 | 0.6 | 3 | 2864.5 | opposite-strand | MatE |
| 2 | PF03466.22 | 0.8 | 4 | 1098.5 | opposite-strand | LysR substrate binding domain |
| 3 | PF00126.29 | 0.8 | 4 | 1098.5 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 4 | PF17969.3 | 1.0 | 5 | -113.0 | opposite-strand | L,D-transpeptidase C-terminal domain |
| 5 | PF03734.16 | 1.0 | 5 | -113.0 | opposite-strand | L,D-transpeptidase catalytic domain |
| 6 | PF02277.19 | 0.8 | 4 | 753 | opposite-strand | Phosphoribosyltransferase |
| 7 | PF02654.17 | 0.8 | 4 | 1844 | opposite-strand | Cobalamin-5-phosphate synthase |
| 8 | PF02283.18 | 0.8 | 4 | 2584 | opposite-strand | Cobinamide kinase / cobinamide phosphate guanyltransferase |
++ More..