Result : EXP00661
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00661 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 663627 |
| Right | 663719 |
| Strand | + |
| Nucleotide Sequence | GTGATGATAACGATATTTGGTGACAAAACTCACAAAAGACACGCGTTTAATTTGCGATACGAATTAAATTTTCACACACTCTGTAGCAGATGA |
| Sequence | VMITIFGDKTHKRHAFNLRYELNFHTLCSR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1480628 | 1480720 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 2 | 685226 | 685318 | + | NZ_AP014857.1 | Escherichia albertii |
| 3 | 703753 | 703845 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 783777 | 783869 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 647990 | 648082 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 6 | 3037442 | 3037534 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 7 | 1339166 | 1339258 | + | NZ_LR134340.1 | Escherichia marmotae |
| 8 | 1948274 | 1948354 | - | NZ_CP038469.1 | Citrobacter tructae |
| 9 | 3220159 | 3220248 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 3721577 | 3721663 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 11 | 745072 | 745161 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 12 | 1568876 | 1568971 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 13 | 3582631 | 3582732 | - | NZ_CP023525.1 | Cedecea neteri |
| 14 | 4323669 | 4323755 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 15 | 1418867 | 1418962 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 16 | 3789575 | 3789670 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 17 | 1415425 | 1415520 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 18 | 1644353 | 1644448 | - | NZ_CP016337.1 | Kosakonia sacchari |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP057657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13982.8 | 0.65 | 11 | 5878.0 | same-strand | YbfN-like lipoprotein |
| 2 | PF03573.15 | 0.94 | 16 | 4429.0 | same-strand | outer membrane porin, OprD family |
| 3 | PF00749.23 | 1.0 | 17 | 2278.5 | same-strand | tRNA synthetases class I (E and Q), catalytic domain |
| 4 | PF03950.20 | 1.0 | 17 | 2278.5 | same-strand | tRNA synthetases class I (E and Q), anti-codon binding domain |
| 5 | PF02378.20 | 1.0 | 17 | 99.0 | same-strand | Phosphotransferase system, EIIC |
| 6 | PF00358.22 | 1.0 | 17 | 99.0 | same-strand | phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 |
| 7 | PF00367.22 | 1.0 | 17 | 99.0 | same-strand | phosphotransferase system, EIIB |
| 8 | PF01182.22 | 1.0 | 17 | 146.5 | opposite-strand | Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase |
| 9 | PF01979.22 | 1.0 | 17 | 1008.0 | opposite-strand | Amidohydrolase family |
| 10 | PF00480.22 | 1.0 | 17 | 2165.0 | opposite-strand | ROK family |
| 11 | PF13412.8 | 1.0 | 17 | 2165.0 | opposite-strand | Winged helix-turn-helix DNA-binding |
| 12 | PF13344.8 | 0.94 | 16 | 3438 | opposite-strand | Haloacid dehalogenase-like hydrolase |
| 13 | PF13242.8 | 1.0 | 17 | 3438.0 | opposite-strand | HAD-hyrolase-like |
| 14 | PF00702.28 | 0.94 | 16 | 3438 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 15 | PF13537.8 | 0.94 | 16 | 4452 | opposite-strand | Glutamine amidotransferase domain |
| 16 | PF13522.8 | 0.94 | 16 | 4452 | opposite-strand | Glutamine amidotransferase domain |
++ More..