Result : EXP00660
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00660 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 2622009 |
| Right | 2622116 |
| Strand | + |
| Nucleotide Sequence | ATTCGACGGGATTTGCGAAACCCAAGGTGCATGCCGAGGGGCGGTTGGCCTCGTAAAAAGCCGCAAAAAATAGTCGCAAACGACGAAAACTACGCTTTAGCAGCTTAA |
| Sequence | IRRDLRNPRCMPRGGWPRKKPQKIVANDENYALAA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 31
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3872327 | 3872422 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 2 | 1203364 | 1203459 | - | NZ_CP054254.1 | Klebsiella variicola |
| 3 | 3475761 | 3475856 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1758380 | 1758475 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 1293650 | 1293745 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 6 | 5053991 | 5054086 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 7 | 4098302 | 4098397 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 8 | 1207977 | 1208072 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 9 | 5080559 | 5080654 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 4338529 | 4338624 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 11 | 3673009 | 3673104 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 12 | 3531252 | 3531347 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 13 | 2724704 | 2724799 | + | NZ_AP014857.1 | Escherichia albertii |
| 14 | 2755619 | 2755714 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 15 | 2754158 | 2754253 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 16 | 4019833 | 4019928 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 17 | 3275788 | 3275883 | + | NZ_LR134340.1 | Escherichia marmotae |
| 18 | 1022167 | 1022262 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 19 | 364148 | 364243 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 20 | 1695662 | 1695757 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 21 | 1213021 | 1213128 | - | NZ_CP006569.1 | Sodalis praecaptivus |
| 22 | 3932045 | 3932155 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 23 | 2899015 | 2899140 | + | NZ_CP039268.1 | Thermochromatium tepidum ATCC 43061 |
| 24 | 1104657 | 1104755 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 25 | 39224 | 39331 | + | NZ_CP038254.1 | Legionella israelensis |
| 26 | 2180306 | 2180425 | + | NZ_AP014879.1 | Sulfuricaulis limicola |
| 27 | 2634797 | 2634895 | - | NC_008344.1 | Nitrosomonas eutropha C91 |
| 28 | 2480912 | 2481010 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 29 | 3889739 | 3889840 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 30 | 1767866 | 1767964 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 31 | 3041909 | 3042007 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 32 | 1607701 | 1607805 | - | NC_011901.1 | Thioalkalivibrio sulfidiphilus HL-EbGr7 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015113.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04355.15 | 0.61 | 19 | 1663.0 | same-strand | SmpA / OmlA family |
| 2 | PF03658.16 | 0.71 | 22 | 1321 | opposite-strand | RnfH family Ubiquitin |
| 3 | PF03364.22 | 0.71 | 22 | 855 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 4 | PF10604.11 | 0.68 | 21 | 855.0 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 5 | PF01668.20 | 0.77 | 24 | 241 | same-strand | SmpB protein |
++ More..