Result : EXP00652
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00652 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 791471 |
| Right | 791677 |
| Strand | + |
| Nucleotide Sequence | ATGAACGTTAAACCCGACCATCGCGCCGCTGGCACCTTCATCGACATCAATACGTTCTATATCCAGCGCGTGAACGGTAAAAATGTAGCGATGAGTTTCGCCTTTCGGCGGTGCTGCGCCATCGTACCCGGTTTTACCAAAGTCGGTACGCGTCTGCAAAACGCCGTCTGGCATTGCTACCAGACCAGAGCCAAACCCTTGCGGTAA |
| Sequence | MNVKPDHRAAGTFIDINTFYIQRVNGKNVAMSFAFRRCCAIVPGFTKVGTRLQNAVWHCYQTRAKPLR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 807478 | 807684 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 750305 | 750511 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 929845 | 930051 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1338786 | 1338992 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 2834358 | 2834564 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 6 | 805454 | 805681 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3030986 | 3031213 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 858308 | 858496 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 3339449 | 3339637 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 46454 | 46660 | + | NZ_CP038469.1 | Citrobacter tructae |
| 11 | 2916660 | 2916836 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 12 | 3104217 | 3104390 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01161.22 | 1.0 | 11 | -206.0 | opposite-strand | Phosphatidylethanolamine-binding protein |
| 2 | PF00202.23 | 1.0 | 11 | 284.0 | opposite-strand | Aminotransferase class-III |
| 3 | PF06968.15 | 1.0 | 11 | 1660.5 | same-strand | Biotin and Thiamin Synthesis associated domain |
| 4 | PF04055.23 | 1.0 | 11 | 1660.5 | same-strand | Radical SAM superfamily |
| 5 | PF00155.23 | 1.0 | 11 | 2697.0 | same-strand | Aminotransferase class I and II |
| 6 | PF08241.14 | 1.0 | 11 | 3838.0 | same-strand | Methyltransferase domain |
| 7 | PF13649.8 | 1.0 | 11 | 3838.0 | same-strand | Methyltransferase domain |
| 8 | PF13489.8 | 1.0 | 11 | 3838.0 | same-strand | Methyltransferase domain |
| 9 | PF08242.14 | 1.0 | 11 | 3838.0 | same-strand | Methyltransferase domain |
| 10 | PF13500.8 | 0.73 | 8 | 4586 | same-strand | AAA domain |
| 11 | PF01656.25 | 0.73 | 8 | 4586 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..