Result : B1W317
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sec-independent protein translocase protein TatA |
| NCBI Accession ID | AP009493.1 |
| Organism | Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) |
| Left | 6871175 |
| Right | 6871474 |
| Strand | + |
| Nucleotide Sequence | ATGATCGGCAATCTGAAGCCCCTCGAGATCGTTCTGATCATCGCTGTCATCCTGCTGCTTTTCGGTGCCAAGAAGCTCCCCGACATGGCGCGCTCGCTCGGCAAGTCGGCCCGCATCCTCAAGAGCGAGGCCAAGGCCATGAAGAAGGACGACGCGGCGACCGCGGCGCCCACGACGGAGACCGTCGCCGACGACACGGTCCCCCCGCAGTCCACCACCGCGCGCACCATCCAGGCCGCTCCGGGAGACGTCACCAGCTCCCGCCCGGTCAGCGAGGCCAAGCCCACCACCCAGAGCTGA |
| Sequence | MIGNLKPLEIVLIIAVILLLFGAKKLPDMARSLGKSARILKSEAKAMKKDDAATAAPTTETVADDTVPPQSTTARTIQAAPGDVTSSRPVSEAKPTTQS |
| Source of smORF | Swiss-Prot |
| Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
| Pubmed ID | 18375553 |
| Domain | CDD:294511 |
| Functional Category | Others |
| Uniprot ID | B1W317 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 85
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 6871175 | 6871474 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 2 | 1371459 | 1371755 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 3 | 6372709 | 6373002 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 4 | 5519798 | 5520091 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 5 | 1168855 | 1169151 | - | NZ_CP070242.1 | Streptomyces californicus |
| 6 | 1156850 | 1157146 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 7 | 1084052 | 1084348 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 8 | 1306843 | 1307139 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 9 | 1143917 | 1144210 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 10 | 5878742 | 5879038 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 11 | 5945204 | 5945500 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 12 | 4867672 | 4867965 | - | NZ_CP030862.1 | Streptomyces globosus |
| 13 | 947176 | 947475 | - | NZ_CP031194.1 | Streptomyces paludis |
| 14 | 5895849 | 5896145 | + | NC_020990.1 | Streptomyces albidoflavus |
| 15 | 389083 | 389373 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 16 | 2615870 | 2616169 | - | NZ_CP070326.1 | Streptomyces noursei |
| 17 | 1067969 | 1068244 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 18 | 6246767 | 6247063 | + | NZ_CP031742.1 | Streptomyces koyangensis |
| 19 | 495518 | 495808 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 20 | 5996672 | 5996953 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 21 | 2417247 | 2417534 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 22 | 10089801 | 10090103 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 23 | 7611932 | 7612216 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 24 | 6174930 | 6175229 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 25 | 1838898 | 1839197 | - | NZ_CP023691.1 | Streptomyces platensis |
| 26 | 2320679 | 2320966 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 27 | 6942144 | 6942431 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 28 | 1022290 | 1022532 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 29 | 1047272 | 1047550 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 30 | 6625604 | 6625888 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 31 | 1430328 | 1430624 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 32 | 2071159 | 2071455 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 33 | 1789379 | 1789678 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 34 | 1347977 | 1348273 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 35 | 2228273 | 2228560 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 36 | 1635066 | 1635356 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 37 | 1740837 | 1741124 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 38 | 7904355 | 7904648 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 39 | 1366678 | 1366965 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 40 | 6423536 | 6423814 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 41 | 1741007 | 1741288 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 42 | 1598260 | 1598547 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 43 | 1339610 | 1339900 | - | NZ_CP029043.1 | Streptomyces nigra |
| 44 | 1750970 | 1751248 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 45 | 1252569 | 1252853 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 46 | 7349011 | 7349295 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 47 | 2032251 | 2032529 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 48 | 8036909 | 8037193 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 49 | 1444545 | 1444835 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 50 | 1637093 | 1637380 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 51 | 1145840 | 1146124 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 52 | 1455442 | 1455723 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 53 | 1536615 | 1536896 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 54 | 3153447 | 3153734 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 55 | 7645118 | 7645402 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 56 | 7893624 | 7893914 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 57 | 2353774 | 2354061 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 58 | 6714727 | 6715014 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 59 | 6872827 | 6873120 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 60 | 1821293 | 1821577 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 61 | 2344543 | 2344833 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 62 | 1780119 | 1780403 | - | NZ_CP022685.1 | Streptomyces formicae |
| 63 | 6837230 | 6837514 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 64 | 7058967 | 7059251 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 65 | 1965142 | 1965426 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 66 | 8136978 | 8137262 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 67 | 1988075 | 1988359 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 68 | 6384064 | 6384345 | + | NZ_CP022310.1 | Streptomyces calvus |
| 69 | 7029139 | 7029420 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 70 | 1872844 | 1873125 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 71 | 8003144 | 8003428 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 72 | 1813660 | 1813959 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 73 | 8137688 | 8137972 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 74 | 7731383 | 7731670 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 75 | 1226452 | 1226700 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 76 | 7668009 | 7668296 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 77 | 1405702 | 1405950 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 78 | 1939557 | 1939850 | - | NZ_CP027306.1 | Streptomyces atratus |
| 79 | 3386368 | 3386625 | + | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 80 | 1565395 | 1565676 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 81 | 2700146 | 2700427 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 82 | 4706028 | 4706291 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 83 | 1481119 | 1481400 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 84 | 6516705 | 6517007 | + | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 85 | 1392633 | 1392911 | + | NZ_CP031423.1 | Microbacterium lemovicicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010572.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00254.30 | 0.95 | 81 | 2954.5 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
| 2 | PF13280.8 | 0.99 | 84 | 1229.0 | same-strand | WYL domain |
| 3 | PF19187.2 | 0.99 | 84 | 801.5 | same-strand | PafC helix-turn-helix domain |
| 4 | PF00902.20 | 0.99 | 84 | 63.0 | same-strand | Sec-independent protein translocase protein (TatC) |
| 5 | PF08148.14 | 0.98 | 83 | 1949 | same-strand | DSHCT (NUC185) domain |
| 6 | PF00270.31 | 0.98 | 83 | 1949 | same-strand | DEAD/DEAH box helicase |
| 7 | PF04851.17 | 0.98 | 83 | 1949 | same-strand | Type III restriction enzyme, res subunit |
++ More..