Result : EXP00651
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00651 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 9192 |
| Right | 9341 |
| Strand | + |
| Nucleotide Sequence | ATTCTTAGCGTGACCGGGAAGTCGGTCACGCTACCTCTTCTGAAGCCTGTCTGTCACTCCCTTCGCAGTGTATCATTCTGTTTAACGAGACTGTTTAAACGGAAAAATCTTGATGAATACTTTACGTATTGGCTTAGTTTCCATCTCTGA |
| Sequence | ILSVTGKSVTLPLLKPVCHSLRSVSFCLTRLFKRKNLDEYFTYWLSFHL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 9220 | 9360 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 9203 | 9343 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 9202 | 9342 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3605336 | 3605476 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 9192 | 9332 | + | NZ_AP014857.1 | Escherichia albertii |
| 6 | 636299 | 636439 | + | NZ_LR134340.1 | Escherichia marmotae |
| 7 | 3541843 | 3541983 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 4896708 | 4896845 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 2669444 | 2669581 | - | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 2224742 | 2224879 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 11 | 3448267 | 3448404 | + | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 1607315 | 1607452 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 13 | 8629 | 8796 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 14 | 4834359 | 4834532 | - | NZ_CP050508.1 | Raoultella terrigena |
| 15 | 4495253 | 4495426 | - | NZ_CP041247.1 | Raoultella electrica |
| 16 | 2506662 | 2506835 | + | NZ_CP026047.1 | Raoultella planticola |
| 17 | 731878 | 732015 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00291.27 | 0.81 | 13 | 3988.5 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 2 | PF14821.8 | 0.81 | 13 | 3988.5 | same-strand | Threonine synthase N terminus |
| 3 | PF03883.16 | 1.0 | 16 | 2744 | opposite-strand | Peroxide stress protein YaaA |
| 4 | PF01235.19 | 0.94 | 15 | 1240.5 | opposite-strand | Sodium:alanine symporter family |
| 5 | PF00923.21 | 1.0 | 16 | 11 | same-strand | Transaldolase/Fructose-6-phosphate aldolase |
| 6 | PF00994.26 | 1.0 | 16 | -37 | same-strand | Probable molybdopterin binding domain |
| 7 | PF01184.21 | 1.0 | 16 | 1998 | opposite-strand | GPR1/FUN34/yaaH family |
| 8 | PF00012.22 | 0.81 | 13 | 2877.5 | same-strand | Hsp70 protein |
++ More..