Result : EXP00643
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00643 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1751952 |
| Right | 1752173 |
| Strand | + |
| Nucleotide Sequence | ATGAGCTGGGAACTAACACTTTTGGACTTATCAGTACCCAAAGTGAAGAAGAAATTAGAGAACTGGTTTCGGGGCTTACCCAAAGTGCAACCGGCAAAGATCCTGAAATCACCATCACGACCTGGGAGGAATGGAATAGCAACAGAAAATAAATGGTTTTTGGGCAATAATCAGTCTGTGGTGTGCGTTAGCTCGTGTTTTTACACCGCATTCTTGCGCTAA |
| Sequence | MSWELTLLDLSVPKVKKKLENWFRGLPKVQPAKILKSPSRPGRNGIATENKWFLGNNQSVVCVSSCFYTAFLR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1807539 | 1807760 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1949893 | 1950114 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 1539040 | 1539261 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2407390 | 2407611 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04338.14 | 0.67 | 2 | 1456 | opposite-strand | Protein of unknown function, DUF481 |
| 2 | PF00294.26 | 1.0 | 3 | 240.0 | same-strand | pfkB family carbohydrate kinase |
| 3 | PF11080.10 | 1.0 | 3 | -151.0 | same-strand | Endoribonuclease GhoS |
| 4 | PF03881.16 | 1.0 | 3 | 36.0 | same-strand | Fructosamine kinase |
| 5 | PF01636.25 | 1.0 | 3 | 36.0 | same-strand | Phosphotransferase enzyme family |
| 6 | PF14002.8 | 1.0 | 3 | 937.0 | opposite-strand | YniB-like protein |
| 7 | PF13419.8 | 1.0 | 3 | 1620.0 | same-strand | Haloacid dehalogenase-like hydrolase |
| 8 | PF04307.16 | 1.0 | 3 | 2451.0 | same-strand | LexA-binding, inner membrane-associated putative hydrolase |
++ More..