Result : EXP00632
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00632 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 879977 |
| Right | 880219 |
| Strand | + |
| Nucleotide Sequence | TTGAGCACTTCTTCGTCCAACCAGTTATTTAGTTCCTGCAATCGTTTCTGCAGGGGCATCAATTCGTTTCTTACGAATACCTTGCTAGCCTTCTCCACATCCCCAAACCCCCCGACATTATTAGGCATAATTCCCATCATTTGCGGCGGCACGCGGTGTGCCGCCATCATGTCATCACGGCTCACGTTCTTGATATTCAGAAACTCATCCTTCGCTGTGACTTCTGACAACGGGATAATCTGA |
| Sequence | LSTSSSNQLFSSCNRFCRGINSFLTNTLLAFSTSPNPPTLLGIIPIICGGTRCAAIMSSRLTFLIFRNSSFAVTSDNGII |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 890046 | 890294 | + | NZ_AP014857.1 | Escherichia albertii |
| 2 | 1821650 | 1821868 | - | NZ_CP038469.1 | Citrobacter tructae |
| 3 | 692808 | 693026 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 4 | 1856897 | 1857133 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 5 | 3520106 | 3520363 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 6 | 2866572 | 2866811 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 7 | 4191359 | 4191607 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 8 | 177839 | 178039 | + | NZ_CP023536.1 | Providencia alcalifaciens |
| 9 | 2668250 | 2668519 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 10 | 3127028 | 3127267 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 11 | 2787294 | 2787494 | + | NZ_CP048796.1 | Providencia vermicola |
| 12 | 1562144 | 1562392 | + | NZ_AP018738.1 | Ferriphaselus amnicola |
| 13 | 29199 | 29444 | - | NZ_CP060790.1 | Acidovorax monticola |
| 14 | 3266471 | 3266716 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 15 | 4510924 | 4511127 | - | NZ_CP018845.1 | Herbaspirillum robiniae |
| 16 | 3687760 | 3688008 | + | NC_017059.1 | Pararhodospirillum photometricum DSM 122 |
| 17 | 4630953 | 4631198 | + | NZ_CP059082.1 | Halomonas titanicae |
| 18 | 4744279 | 4744527 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 19 | 1971094 | 1971342 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 20 | 3495019 | 3495234 | + | NC_008781.1 | Polaromonas naphthalenivorans CJ2 |
| 21 | 1589236 | 1589481 | - | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 22 | 397034 | 397249 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 23 | 4311968 | 4312228 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 24 | 403003 | 403209 | - | NZ_CP044060.1 | Aeromonas veronii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03237.17 | 0.88 | 21 | 755 | opposite-strand | Terminase large subunit, T4likevirus-type, N-terminal |
| 2 | PF17289.4 | 0.88 | 21 | 755 | opposite-strand | Terminase RNaseH-like domain |
| 3 | PF06056.14 | 0.88 | 21 | 755 | opposite-strand | Putative ATPase subunit of terminase (gpP-like) |
| 4 | PF05929.13 | 0.88 | 21 | 2670 | same-strand | Phage capsid scaffolding protein (GPO) serine peptidase |
| 5 | PF05125.14 | 0.88 | 21 | 3525 | same-strand | Phage major capsid protein, P2 family |
| 6 | PF05944.14 | 0.88 | 21 | 4597 | same-strand | Phage small terminase subunit |
++ More..