Result : A0Q5J3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
| NCBI Accession ID | CP000439.1 |
| Organism | Francisella tularensis subsp. novicida (strain U112) |
| Left | 645826 |
| Right | 646044 |
| Strand | + |
| Nucleotide Sequence | ATGGCTAGAGTAACAGTAGAAGATTGCTTAGATAAAGTAGAAACAAGATTTGATTTAGTAGTTTTAGCTTCTATGCGAGCAAATAAGATACTAAAAAATGGCTACTCTGAATCTATGGAAAATGAGAAAAAAGAAAAAGCAACGGTTGTGGCTTTAAGAGAAATTGCTGAGTCAGAAATTACCCCAGAACAAATCTTAAGAAATGAGATAGAAGGATAA |
| Sequence | MARVTVEDCLDKVETRFDLVVLASMRANKILKNGYSESMENEKKEKATVVALREIAESEITPEQILRNEIEG |
| Source of smORF | Swiss-Prot |
| Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000255|HAMAP-Rule:MF_00366}. |
| Pubmed ID | 17550600 |
| Domain | CDD:417484 |
| Functional Category | Others |
| Uniprot ID | A0Q5J3 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 562977 | 563195 | + | NC_017449.1 | Francisella hispaniensis |
| 2 | 549105 | 549323 | + | NZ_CP022375.1 | Francisella opportunistica |
| 3 | 469693 | 469911 | + | NZ_CP012505.1 | Francisella persica ATCC VR-331 |
| 4 | 1759841 | 1760059 | - | NC_015696.1 | Francisella salina |
| 5 | 1169402 | 1169620 | - | NZ_CP043552.1 | Francisella marina |
| 6 | 662655 | 662873 | + | NZ_CP016796.1 | Francisella uliginis |
| 7 | 649449 | 649667 | + | NC_023029.1 | Francisella orientalis LADL--07-285A |
| 8 | 1220029 | 1220247 | - | NZ_CP022132.1 | Francisella halioticida |
| 9 | 742591 | 742806 | + | NZ_CP010427.1 | Allofrancisella guangzhouensis |
| 10 | 1263650 | 1263859 | - | NZ_CP009654.1 | Francisella frigiditurris |
| 11 | 1092651 | 1092866 | - | NZ_CP038017.1 | Allofrancisella frigidaquae |
| 12 | 591483 | 591698 | + | NZ_CP038241.1 | Allofrancisella inopinata |
| 13 | 1276928 | 1277143 | - | NZ_CP021781.1 | Francisella adeliensis |
| 14 | 162747 | 162974 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 15 | 3641005 | 3641244 | - | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 16 | 6454038 | 6454247 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 17 | 714221 | 714433 | + | NZ_CP043042.1 | Marinobacter fonticola |
| 18 | 3547691 | 3547900 | - | NZ_CP011797.1 | Reinekea forsetii |
| 19 | 3888182 | 3888394 | - | NZ_CP020931.1 | Marinobacter salarius |
| 20 | 294576 | 294788 | + | NC_017506.1 | Marinobacter adhaerens HP15 |
| 21 | 1040244 | 1040447 | + | NC_013861.1 | Legionella longbeachae NSW150 |
| 22 | 2421046 | 2421270 | + | NZ_AP020335.1 | Hydrogenovibrio marinus |
| 23 | 3086647 | 3086850 | + | NZ_LR134374.1 | Legionella spiritensis |
| 24 | 2463733 | 2463939 | - | NZ_LN614827.1 | Legionella fallonii LLAP-10 |
| 25 | 2520718 | 2520942 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 26 | 2761258 | 2761461 | - | NZ_LN614830.1 | Tatlockia micdadei |
| 27 | 3749858 | 3750070 | + | NZ_AP014545.1 | Amphritea japonica ATCC BAA-1530 |
| 28 | 2763497 | 2763709 | - | NZ_CP017715.1 | Marinobacter salinus |
| 29 | 2149961 | 2150164 | - | NZ_CP038254.1 | Legionella israelensis |
| 30 | 3259857 | 3260063 | - | NC_023018.2 | Pandoraea pnomenusa |
| 31 | 1539203 | 1539415 | + | NZ_CP021425.1 | Oleiphilus messinensis |
| 32 | 2394947 | 2395150 | - | NZ_LT906442.1 | Legionella waltersii |
| 33 | 137516 | 137719 | - | NZ_LR134418.1 | Legionella adelaidensis |
| 34 | 2260487 | 2260690 | - | NZ_CP013742.1 | Legionella pneumophila |
| 35 | 486161 | 486364 | + | NZ_CP025491.2 | Legionella sainthelensi |
| 36 | 1286445 | 1286648 | + | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 37 | 1356050 | 1356253 | + | NZ_AP014568.1 | Serpentinomonas raichei |
| 38 | 80298 | 80522 | - | NZ_CP007030.1 | Thiomicrospira aerophila AL3 |
| 39 | 48018 | 48242 | - | NC_015581.1 | Thiomicrospira cyclica ALM1 |
| 40 | 1103717 | 1103920 | - | NZ_CP017476.1 | Hydrogenophaga crassostreae |
| 41 | 2634443 | 2634652 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 42 | 2299812 | 2300021 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 43 | 701266 | 701469 | + | NZ_LN681225.1 | Legionella hackeliae |
| 44 | 2013880 | 2014083 | - | NZ_CP020121.1 | Comamonas kerstersii |
| 45 | 1902190 | 1902414 | + | NZ_CP070273.1 | Marinomonas foliarum |
| 46 | 611140 | 611343 | + | NZ_LT906451.1 | Legionella lansingensis |
| 47 | 2887388 | 2887591 | + | NC_008825.1 | Methylibium petroleiphilum PM1 |
| 48 | 1173444 | 1173650 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 49 | 701941 | 702144 | - | NZ_CP051461.1 | Polaromonas vacuolata |
| 50 | 65194 | 65433 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 51 | 3702519 | 3702725 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 52 | 3732956 | 3733165 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 53 | 4441438 | 4441662 | + | NZ_CP061081.1 | Marinomonas arctica |
| 54 | 2379475 | 2379684 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 55 | 2572243 | 2572446 | - | NZ_CP016397.1 | Legionella clemsonensis |
| 56 | 3420841 | 3421053 | - | NZ_CP043869.1 | Neptunomonas concharum |
| 57 | 3815607 | 3815831 | + | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 58 | 1676638 | 1676844 | + | NZ_CP013816.1 | Piscirickettsia salmonis |
| 59 | 2219484 | 2219690 | - | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 60 | 159611 | 159823 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP051183.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01138.23 | 0.62 | 37 | 1893 | opposite-strand | 3' exoribonuclease family, domain 1 |
| 2 | PF03725.17 | 0.62 | 37 | 1893 | opposite-strand | 3' exoribonuclease family, domain 2 |
| 3 | PF00625.23 | 0.7 | 42 | 65.0 | same-strand | Guanylate kinase |
| 4 | PF13328.8 | 0.75 | 45 | 124 | same-strand | HD domain |
| 5 | PF04607.19 | 0.75 | 45 | 124 | same-strand | Region found in RelA / SpoT proteins |
| 6 | PF02824.23 | 0.75 | 45 | 124 | same-strand | TGS domain |
| 7 | PF13291.8 | 0.75 | 45 | 124 | same-strand | ACT domain |
| 8 | PF01966.24 | 0.75 | 45 | 124 | same-strand | HD domain |
++ More..