Result : EXP00621
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00621 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1151342 |
| Right | 1151551 |
| Strand | + |
| Nucleotide Sequence | TTGGTACTGGCAGCTATCTGCCCGAACAAGTGCGGACAAACGCCGATTTGGAAAAAATGGTGGACACCTCTGACGAGTGGATTGTCACTCGTACCGGTATCCGCGAACGCCACATTGCCGCGCAAAACGAAACCGTTTCAACCATGGGCTTTGAAGCGGCGACACGCGCAATTGAGATGGCGGGCATTGAGAAAGACCAGATTGGCCTGA |
| Sequence | LVLAAICPNKCGQTPIWKKWWTPLTSGLSLVPVSANATLPRKTKPFQPWALKRRHAQLRWRALRKTRLA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1136492 | 1136701 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1148775 | 1148984 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1508011 | 1508220 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 1729803 | 1730012 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 1791717 | 1791926 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1156872 | 1157081 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3667379 | 3667588 | + | NZ_CP053416.1 | Salmonella bongori |
| 8 | 1277318 | 1277527 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 1689996 | 1690205 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 10 | 3627957 | 3628166 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 3442612 | 3442821 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 2453364 | 2453573 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 13 | 2342687 | 2342896 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 14 | 1542298 | 1542537 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 15 | 1244597 | 1244806 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 16 | 1591629 | 1591868 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 17 | 1702682 | 1702891 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 18 | 1708405 | 1708614 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 19 | 4628901 | 4629110 | + | NZ_CP033744.1 | Citrobacter freundii |
| 20 | 489093 | 489302 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 21 | 1275235 | 1275444 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 22 | 2509303 | 2509473 | - | NZ_CP038853.1 | Pantoea vagans |
| 23 | 1549603 | 1549812 | - | NZ_CP038469.1 | Citrobacter tructae |
| 24 | 4139512 | 4139751 | - | NZ_CP019706.1 | Pantoea alhagi |
| 25 | 1524401 | 1524571 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 26 | 1917627 | 1917836 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 27 | 1122973 | 1123182 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 28 | 2540769 | 2540978 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 29 | 2759115 | 2759324 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 30 | 1790184 | 1790402 | + | NZ_CP026377.1 | Mixta gaviniae |
| 31 | 2848672 | 2848881 | - | NZ_LR134201.1 | Cedecea lapagei |
| 32 | 2765935 | 2766144 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 33 | 3075226 | 3075435 | - | NZ_CP023525.1 | Cedecea neteri |
| 34 | 3751355 | 3751564 | - | NZ_CP060111.1 | Klebsiella michiganensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_004337.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02545.16 | 0.97 | 32 | 2044 | opposite-strand | Maf-like protein |
| 2 | PF02620.19 | 1.0 | 33 | 1381.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
| 3 | PF01783.25 | 1.0 | 33 | 1191.0 | same-strand | Ribosomal L32p protein family |
| 4 | PF02504.17 | 0.97 | 32 | 56 | same-strand | Fatty acid synthesis protein |
| 5 | PF08541.12 | 1.0 | 33 | -209.0 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 6 | PF08545.12 | 1.0 | 33 | -209.0 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
| 7 | PF00698.23 | 1.0 | 33 | 745.0 | same-strand | Acyl transferase domain |
| 8 | PF13561.8 | 1.0 | 33 | 1687.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 9 | PF00106.27 | 1.0 | 33 | 1687.0 | same-strand | short chain dehydrogenase |
| 10 | PF08659.12 | 1.0 | 33 | 1687.0 | same-strand | KR domain |
| 11 | PF13460.8 | 1.0 | 33 | 1687.0 | same-strand | NAD(P)H-binding |
| 12 | PF00550.27 | 1.0 | 33 | 2578.0 | same-strand | Phosphopantetheine attachment site |
| 13 | PF00109.28 | 1.0 | 33 | 2907.0 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 14 | PF02801.24 | 1.0 | 33 | 2907.0 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
++ More..