Result : EXP00618
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00618 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1321942 |
| Right | 1322037 |
| Strand | + |
| Nucleotide Sequence | ATGATCAACACAAATATGAAATATTGGTCCTGGATGGGCGCGTTTTCTCTGTCGATGCTCTTCTGGGCCGAACTCCTCTGGATCATTACTCACTGA |
| Sequence | MINTNMKYWSWMGAFSLSMLFWAELLWIITH |
| Source of smORF | Ribo-seq |
| Function | integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];INDUCTION: Expressed during stationary phase (at protein level) Pubmed:29645342 |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Gene Ontology/Expression based functional assignment |
| Uniprot ID | P0DPO1 |
| ORF Length (Amino Acid) | 31 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1836416 | 1836511 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1335572 | 1335667 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1329856 | 1329951 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1837115 | 1837210 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 5 | 2402813 | 2402908 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3991844 | 3991939 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 7 | 2959916 | 2960011 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 8 | 712674 | 712769 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 9 | 1320772 | 1320867 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 10 | 1807607 | 1807699 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 11 | 4319007 | 4319099 | - | NZ_CP053416.1 | Salmonella bongori |
| 12 | 1400269 | 1400370 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 13 | 4089326 | 4089421 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 14 | 2552073 | 2552162 | - | NC_015968.1 | Enterobacter soli |
| 15 | 1632537 | 1632635 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 16 | 1062624 | 1062722 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 17 | 2590586 | 2590684 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 18 | 2640963 | 2641043 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 19 | 2590724 | 2590810 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 20 | 467355 | 467444 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 21 | 2048100 | 2048198 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 22 | 2805303 | 2805392 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 23 | 4677846 | 4677935 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 24 | 2546989 | 2547078 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 25 | 2390698 | 2390796 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 26 | 858475 | 858564 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 27 | 1833695 | 1833793 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 28 | 2322674 | 2322772 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 29 | 2388965 | 2389063 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 30 | 521510 | 521590 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 31 | 2583914 | 2584003 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 32 | 2597832 | 2597912 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 33 | 2232124 | 2232204 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 34 | 2981786 | 2981884 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 35 | 472270 | 472350 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 36 | 2034738 | 2034836 | - | NZ_CP011602.1 | Phytobacter ursingii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT556085.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10692.11 | 1.0 | 35 | 4957.0 | opposite-strand | Protein of unknown function (DUF2498) |
| 2 | PF01131.22 | 1.0 | 35 | 1960.5 | same-strand | DNA topoisomerase |
| 3 | PF08272.13 | 1.0 | 35 | 1960.5 | same-strand | Topoisomerase I zinc-ribbon-like |
| 4 | PF01751.24 | 1.0 | 35 | 1960.5 | same-strand | Toprim domain |
| 5 | PF01396.21 | 1.0 | 35 | 1960.5 | same-strand | Topoisomerase DNA binding C4 zinc finger |
| 6 | PF03466.22 | 1.0 | 35 | 798.0 | same-strand | LysR substrate binding domain |
| 7 | PF00126.29 | 1.0 | 35 | 798.0 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 8 | PF00330.22 | 0.97 | 34 | 168 | same-strand | Aconitase family (aconitate hydratase) |
| 9 | PF00694.21 | 0.97 | 34 | 168 | same-strand | Aconitase C-terminal domain |
| 10 | PF00925.22 | 0.97 | 34 | 2903 | opposite-strand | GTP cyclohydrolase II |
| 11 | PF01569.23 | 0.97 | 34 | 3685 | same-strand | PAP2 superfamily |
| 12 | PF06305.13 | 0.97 | 34 | 4595 | same-strand | Lipopolysaccharide assembly protein A domain |
| 13 | PF14559.8 | 0.86 | 30 | 4906 | same-strand | Tetratricopeptide repeat |
| 14 | PF18073.3 | 0.94 | 33 | 4908.0 | same-strand | Rubredoxin metal binding domain |
| 15 | PF13424.8 | 0.86 | 30 | 4910 | same-strand | Tetratricopeptide repeat |
| 16 | PF08496.12 | 0.77 | 27 | 5255 | same-strand | Peptidase family S49 N-terminal |
| 17 | PF01343.20 | 0.77 | 27 | 5255 | same-strand | Peptidase family S49 |
++ More..