Result : EXP00613
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00613 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 4543301 |
| Right | 4543531 |
| Strand | + |
| Nucleotide Sequence | ATGAATGCGGGGCCGATTATCCGCGCTGGCAGGGGCAGTGCAGTGCCTGTCATGCCTGGAACACCATCACCGAGGTGCGTCTTGCTGCGTCGCCAACGGTGGCGCGTAACGAGCGTCTCAGCGGCTATGCCGGTAGCGCCGGGGTGGCAAAAGTCCAGAAACTCTCCGATATCAGCCTTGAAGAGCTGCCGCGTTTTTCCACCGGATTTAAAGAGTTCGACCGCGTACTAG |
| Sequence | MNAGPIIRAGRGSAVPVMPGTPSPRCVLLRRQRWRVTSVSAAMPVAPGWQKSRNSPISALKSCRVFPPDLKSSTAY |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4591551 | 4591781 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 5482872 | 5483102 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 4625946 | 4626176 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 3630009 | 3630272 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 611583 | 611813 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3516735 | 3516965 | + | NZ_CP057657.1 | Escherichia fergusonii |
| 7 | 3169210 | 3169473 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 8 | 3424020 | 3424283 | + | NZ_CP033744.1 | Citrobacter freundii |
| 9 | 1631479 | 1631742 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 10 | 5174738 | 5174980 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 1360008 | 1360271 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 733706 | 733948 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 13 | 4488408 | 4488671 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 14 | 4761219 | 4761461 | - | NZ_CP054254.1 | Klebsiella variicola |
| 15 | 5131212 | 5131475 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 16 | 710029 | 710292 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 17 | 727701 | 727964 | + | NC_014306.1 | Erwinia billingiae Eb661 |
| 18 | 3188895 | 3189161 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 19 | 2363515 | 2363778 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 20 | 5096006 | 5096269 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 21 | 491652 | 491915 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 22 | 3977909 | 3978151 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 23 | 4130339 | 4130605 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 24 | 658009 | 658272 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 25 | 3475379 | 3475642 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 26 | 2374689 | 2374952 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 27 | 4596300 | 4596563 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 28 | 668830 | 669042 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 29 | 4408737 | 4409000 | - | NZ_CP071320.1 | Serratia ureilytica |
| 30 | 4382079 | 4382342 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 31 | 2253399 | 2253644 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 32 | 2341637 | 2341870 | + | NZ_CP042941.1 | Atlantibacter hermannii |
| 33 | 536732 | 536998 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 34 | 2770018 | 2770230 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 35 | 3509421 | 3509633 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 36 | 3939747 | 3940001 | - | NZ_LR134201.1 | Cedecea lapagei |
| 37 | 3376109 | 3376321 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 38 | 2697410 | 2697655 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 39 | 3516922 | 3517194 | + | NZ_CP049115.1 | Pantoea stewartii |
| 40 | 535382 | 535648 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 41 | 1790167 | 1790439 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10437.11 | 0.75 | 30 | 1829 | opposite-strand | Bacterial lipoate protein ligase C-terminus |
| 2 | PF03099.21 | 0.75 | 30 | 1829 | opposite-strand | Biotin/lipoate A/B protein ligase family |
| 3 | PF10144.11 | 1.0 | 40 | 1157 | opposite-strand | Bacterial virulence factor haemolysin |
| 4 | PF18429.3 | 1.0 | 40 | 54 | same-strand | Domain of unknown function (DUF5609) |
| 5 | PF12710.9 | 0.85 | 34 | 58 | same-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF00702.28 | 1.0 | 40 | 54.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF13481.8 | 1.0 | 40 | -263 | same-strand | AAA domain |
| 8 | PF18073.3 | 1.0 | 40 | -263 | same-strand | Rubredoxin metal binding domain |
| 9 | PF13521.8 | 1.0 | 40 | 1139 | same-strand | AAA domain |
| 10 | PF01381.24 | 1.0 | 40 | 1147.0 | same-strand | Helix-turn-helix |
| 11 | PF12844.9 | 1.0 | 40 | 1143.0 | same-strand | Helix-turn-helix domain |
| 12 | PF00005.29 | 0.65 | 26 | 2679 | opposite-strand | ABC transporter |
| 13 | PF12848.9 | 0.62 | 25 | 2679.0 | opposite-strand | ABC transporter |
| 14 | PF01048.22 | 0.6 | 24 | 2954.0 | same-strand | Phosphorylase superfamily |
++ More..