Result : EXP00604
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00604 |
| NCBI Accession ID | CP001509.3 |
| Organism | Escherichia coli BL21(DE3) |
| Left | 1458973 |
| Right | 1459221 |
| Strand | + |
| Nucleotide Sequence | ATCGGTTTCTGTCAGCGATTAAATTCAACACCACGTAACAAACGCCTCCGGCAATTAATCCCCAAAACGCAGAACCAATCCCGACCAGCGTCAATCCACTTGCCGTTACCAGAAATGCCACCACCGCCGCGTCTCGCTCACGCTCATTATGCAGCGCCTGATACAAACTGCCGCCGATGGTACTTAACAGCGCCAGACCTGCCAGCATCTGGATCCAACTTACGGGCAGGGCAGCCATCATCCCGGTAA |
| Sequence | IGFCQRLNSTPRNKRLRQLIPKTQNQSRPASIHLPLPEMPPPPRLAHAHYAAPDTNCRRWYLTAPDLPASGSNLRAGQPSSR |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 30904393 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1504895 | 1505158 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 2020795 | 2021058 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2261521 | 2261769 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03595.19 | 1.0 | 2 | 1584 | same-strand | Voltage-dependent anion channel |
| 2 | PF03848.16 | 1.0 | 2 | 994 | same-strand | Tellurite resistance protein TehB |
| 3 | PF13649.8 | 1.0 | 2 | 994 | same-strand | Methyltransferase domain |
| 4 | PF08241.14 | 1.0 | 2 | 994 | same-strand | Methyltransferase domain |
| 5 | PF08242.14 | 1.0 | 2 | 994 | same-strand | Methyltransferase domain |
| 6 | PF11769.10 | 1.0 | 2 | 22 | same-strand | Protein of unknown function (DUF3313) |
| 7 | PF03594.15 | 1.0 | 2 | -250 | opposite-strand | Benzoate membrane transport protein |
| 8 | PF01381.24 | 1.0 | 2 | 1014 | same-strand | Helix-turn-helix |
| 9 | PF13560.8 | 1.0 | 2 | 1014 | same-strand | Helix-turn-helix domain |
| 10 | PF07883.13 | 1.0 | 2 | 1014 | same-strand | Cupin domain |
| 11 | PF01136.21 | 1.0 | 2 | 1596 | same-strand | Peptidase family U32 |
| 12 | PF12392.10 | 1.0 | 2 | 1596 | same-strand | Collagenase |
| 13 | PF07927.14 | 1.0 | 2 | 4128 | same-strand | HicA toxin of bacterial toxin-antitoxin, |
| 14 | PF18836.3 | 1.0 | 2 | 2699.5 | opposite-strand | YdcK Beta solenoid repeat |
++ More..