Result : B1VAG0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S20 |
| NCBI Accession ID | AM422018.1 |
| Organism | Phytoplasma australiense |
| Left | 591964 |
| Right | 592230 |
| Strand | - |
| Nucleotide Sequence | ATGGCAAATATTAAGCAGCAAAAAAAACGCAACAAAACTAATGAAAAACGTCGTCTTAGAAACATTTCTTTTAAATCGGCGACAAAAACAATTGTTAAACAAGTTAAAATAGCAGTTGAACAAGCTGATAAAGCAAAAGCATTAGCAAATTTATCCCTCGCTTATCAAAAGTTAGATAAAGGAGCTAGTAAAAAGATATATCACGCTAATTTTGTAAACCGCAACAAAGCCAATTTACAAAAATTAGTTAATACTATTTTAAGTTAA |
| Sequence | MANIKQQKKRNKTNEKRRLRNISFKSATKTIVKQVKIAVEQADKAKALANLSLAYQKLDKGASKKIYHANFVNRNKANLQKLVNTILS |
| Source of smORF | Swiss-Prot |
| Function | Binds directly to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00500}. |
| Pubmed ID | 18359806 |
| Domain | CDD:412349 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1VAG0 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 794762 | 795022 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 1102531 | 1102794 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 3 | 925706 | 925966 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 4 | 1112711 | 1112971 | + | NC_022549.1 | Acholeplasma brassicae |
| 5 | 611731 | 611991 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 6 | 1736949 | 1737212 | + | NZ_CP009215.1 | Corynebacterium ureicelerivorans |
| 7 | 1766357 | 1766620 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 8 | 1380955 | 1381218 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 9 | 2011256 | 2011519 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 10 | 1714060 | 1714320 | - | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 11 | 482450 | 482716 | - | NZ_CP066065.1 | Schaalia meyeri |
| 12 | 520231 | 520491 | - | NZ_LR134477.1 | Actinomyces viscosus |
| 13 | 1347663 | 1347923 | - | NC_015671.1 | Cellulomonas gilvus ATCC 13127 |
| 14 | 195153 | 195413 | - | NZ_LR134350.1 | Actinomyces howellii |
| 15 | 2588742 | 2589002 | + | NZ_CP066049.1 | Actinomyces naeslundii |
| 16 | 1141946 | 1142206 | - | NZ_CP025227.1 | Actinomyces wuliandei |
| 17 | 1546791 | 1547051 | + | NZ_CP066060.1 | Actinomyces oris |
| 18 | 996213 | 996473 | - | NZ_CP053642.1 | Actinomyces marmotae |
| 19 | 1332656 | 1332916 | - | NZ_CP023445.1 | Actinosynnema pretiosum |
| 20 | 1351197 | 1351457 | - | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 21 | 1343447 | 1343707 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
| 22 | 2477284 | 2477550 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 23 | 244988 | 245254 | + | NZ_CP022316.1 | Brachybacterium avium |
| 24 | 1418135 | 1418395 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 25 | 1519501 | 1519761 | + | NZ_CP066802.1 | Actinomyces weissii |
| 26 | 864786 | 865052 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 27 | 1943944 | 1944210 | + | NC_013172.1 | Brachybacterium faecium DSM 4810 |
| 28 | 1937645 | 1937905 | - | NZ_LR134363.1 | Actinomyces slackii |
| 29 | 241471 | 241731 | - | NZ_CP014209.1 | Isoptericola dokdonensis DS-3 |
| 30 | 942462 | 942725 | - | NZ_LT635455.1 | Olsenella timonensis |
| 31 | 821004 | 821267 | - | NZ_AP019367.1 | Parolsenella catena |
| 32 | 1192876 | 1193136 | + | NZ_LR134357.1 | Actinomyces israelii |
| 33 | 1673784 | 1674044 | + | NZ_LS483423.1 | Jonesia denitrificans |
| 34 | 1323333 | 1323596 | - | NZ_LR134479.1 | Rothia aeria |
| 35 | 2838508 | 2838768 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 36 | 2467600 | 2467866 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 37 | 460946 | 461191 | + | NZ_CP024965.1 | Entomoplasma somnilux |
| 38 | 2639112 | 2639372 | + | NZ_CP029642.1 | Arthrobacter dokdonellae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR215048.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12836.9 | 0.68 | 26 | 4115.0 | opposite-strand | Helix-hairpin-helix motif |
| 2 | PF03772.18 | 0.68 | 26 | 2428.0 | opposite-strand | Competence protein |
++ More..