Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00592 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 5475656 |
Right | 5475922 |
Strand | - |
Nucleotide Sequence | ATGAAAGAGTTTTTATTTTTATTTCACTCCACGGTCGGCGTCATACAAACCCGCAAGGCGTTGCAGGCAGCGGGCATGACTTTTCGCGTCAGCGATATTCCCCGTGATTTACGCGGCGGCTGCGGGTTATGCATTTGGCTGACCTGTCCCCCCGGCGAGGAAATACAATGGGTGATCCCTGGGCAAACCGAAGCGATATATTGCCAGCAGGGCAGCGACTGGCAGTGCGTGGTGCATTACGATGCAGAAGCGTCAACCAGGCAATAG |
Sequence | MKEFLFLFHSTVGVIQTRKALQAAGMTFRVSDIPRDLRGGCGLCIWLTCPPGEEIQWVIPGQTEAIYCQQGSDWQCVVHYDAEASTRQ |
Source of smORF | Ribo-seq |
Function | Transcriptionally upregulated on exposure to Acanthamoeba castellanii. Pubmed:26911138 The ORF matches to the profile of pfam11823. Profile Description: Protein of unknown function (DUF3343). This family of proteins are functionally uncharacterized. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. |
Pubmed ID | 26911138 |
Domain | CDD:403124 |
Functional Category | Manually curated function from literature |
Uniprot ID | P0DN74 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 5426911 | 5427177 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 4563668 | 4563925 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
3 | 3677295 | 3677552 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 4590311 | 4590574 | - | NZ_AP014857.1 | Escherichia albertii |
5 | 556782 | 557039 | - | NZ_LR134340.1 | Escherichia marmotae |
6 | 1281872 | 1282129 | - | NZ_CP045205.1 | Citrobacter telavivensis |
7 | 2158152 | 2158406 | + | NZ_CP057657.1 | Escherichia fergusonii |
8 | 430827 | 431102 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
9 | 3225597 | 3225848 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
10 | 3776735 | 3776992 | + | NZ_CP023525.1 | Cedecea neteri |
11 | 5317101 | 5317355 | + | NZ_CP060111.1 | Klebsiella michiganensis |
12 | 2414597 | 2414851 | - | NZ_CP026047.1 | Raoultella planticola |
13 | 5211095 | 5211352 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
14 | 1691256 | 1691507 | + | NZ_CP044098.1 | Citrobacter portucalensis |
15 | 4926476 | 4926724 | + | NZ_CP050508.1 | Raoultella terrigena |
16 | 3931092 | 3931334 | + | NZ_CP011602.1 | Phytobacter ursingii |
17 | 4577152 | 4577406 | + | NZ_CP041247.1 | Raoultella electrica |
18 | 1917829 | 1918080 | - | NZ_CP042941.1 | Atlantibacter hermannii |
19 | 5214495 | 5214764 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
20 | 441632 | 441868 | - | NZ_CP015113.1 | Kosakonia radicincitans |
21 | 4646913 | 4647149 | + | NZ_CP014007.2 | Kosakonia oryzae |
22 | 4565217 | 4565471 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
23 | 2423923 | 2424159 | + | NZ_CP045300.1 | Kosakonia arachidis |
24 | 4823563 | 4823817 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
25 | 4537601 | 4537855 | + | NZ_LR134475.1 | Klebsiella aerogenes |
26 | 651216 | 651470 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
27 | 620800 | 621039 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
28 | 658774 | 659013 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
29 | 2415028 | 2415267 | + | NZ_CP016337.1 | Kosakonia sacchari |
30 | 3786560 | 3786787 | + | NZ_CP050150.1 | Hafnia alvei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01869.22 | 0.93 | 27 | -3.0 | same-strand | BadF/BadG/BcrA/BcrD ATPase family |
2 | PF06050.15 | 0.93 | 27 | 774.0 | same-strand | 2-hydroxyglutaryl-CoA dehydratase, D-component |
3 | PF04286.14 | 0.66 | 19 | 2285.5 | same-strand | Protein of unknown function (DUF445) |