Result : EXP00588
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00588 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4892778 |
| Right | 4892984 |
| Strand | - |
| Nucleotide Sequence | ATGGTGGTTTGCCTACCTACTGACATCAATCATTTTAAGCCTGTCGCCAGGCTCTGGTGCAATCAACACTATGACCACCTCGCTCAACCACGGTTATCGCGGCGCGGTGGCGTCTATTGCCGGGCTTCAGACCGGACTGGCGATTCATATTGTGCTGGTTGGCGTGGGGTTGGGGACGCTATTTTCCCGCTCAGTGATTGCGTTTGA |
| Sequence | MVVCLPTDINHFKPVARLWCNQHYDHLAQPRLSRRGGVYCRASDRTGDSYCAGWRGVGDAIFPLSDCV |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 68 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4805279 | 4805485 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4341955 | 4342161 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 4021983 | 4022189 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4008842 | 4009048 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 5932830 | 5933036 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 6 | 2309433 | 2309639 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 7 | 2779397 | 2779603 | - | NZ_CP033744.1 | Citrobacter freundii |
| 8 | 5065209 | 5065415 | + | NZ_CP041247.1 | Raoultella electrica |
| 9 | 3321014 | 3321220 | + | NZ_CP038469.1 | Citrobacter tructae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03061.24 | 1.0 | 8 | 4145 | same-strand | Thioesterase superfamily |
| 2 | PF02253.17 | 1.0 | 8 | 3111 | opposite-strand | Phospholipase A1 |
| 3 | PF09382.12 | 1.0 | 8 | 1149 | opposite-strand | RQC domain |
| 4 | PF00271.33 | 1.0 | 8 | 1149 | opposite-strand | Helicase conserved C-terminal domain |
| 5 | PF00570.25 | 1.0 | 8 | 1149 | opposite-strand | HRDC domain |
| 6 | PF00270.31 | 1.0 | 8 | 1149 | opposite-strand | DEAD/DEAH box helicase |
| 7 | PF16124.7 | 1.0 | 8 | 1149 | opposite-strand | RecQ zinc-binding |
| 8 | PF01810.20 | 1.0 | 8 | 121.0 | both-strands | LysE type translocator |
| 9 | PF12146.10 | 1.0 | 8 | 122 | opposite-strand | Serine aminopeptidase, S33 |
| 10 | PF00561.22 | 1.0 | 8 | 122 | opposite-strand | alpha/beta hydrolase fold |
| 11 | PF12697.9 | 0.88 | 7 | 122.0 | opposite-strand | Alpha/beta hydrolase family |
| 12 | PF08282.14 | 1.0 | 8 | 1153 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 13 | PF00892.22 | 1.0 | 8 | 2030 | opposite-strand | EamA-like transporter family |
| 14 | PF03466.22 | 1.0 | 8 | 2816 | same-strand | LysR substrate binding domain |
| 15 | PF00126.29 | 1.0 | 8 | 2816 | same-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
++ More..