Result : EXP00587
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00587 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4889679 |
| Right | 4889840 |
| Strand | + |
| Nucleotide Sequence | GTGGTTGGCAAATCTGGAATCCAGCATCCAGGATTACCCTCTCAGAGACTAAAAGCATTGCAGTTTCTCGCGCAGGCGCTGAAAATAGCGCCTGTTTTTATTTCAGGCAATCGGGGTGAATGTGGCGCAGGCGGAAGTGTTGAATCTGGAGTCCGGAGCTAA |
| Sequence | VVGKSGIQHPGLPSQRLKALQFLAQALKIAPVFISGNRGECGAGGSVESGVRS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4802180 | 4802341 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4005743 | 4005904 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4018884 | 4019045 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 4338856 | 4339017 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 3976646 | 3976807 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00892.22 | 1.0 | 4 | 1565.0 | opposite-strand | EamA-like transporter family |
| 2 | PF03061.24 | 1.0 | 4 | 1046 | opposite-strand | Thioesterase superfamily |
| 3 | PF02253.17 | 1.0 | 4 | 12 | same-strand | Phospholipase A1 |
| 4 | PF09382.12 | 1.0 | 4 | -46 | same-strand | RQC domain |
| 5 | PF00271.33 | 1.0 | 4 | -46 | same-strand | Helicase conserved C-terminal domain |
| 6 | PF00570.25 | 1.0 | 4 | -46 | same-strand | HRDC domain |
| 7 | PF00270.31 | 1.0 | 4 | -46 | same-strand | DEAD/DEAH box helicase |
| 8 | PF16124.7 | 1.0 | 4 | -46 | same-strand | RecQ zinc-binding |
| 9 | PF01810.20 | 1.0 | 4 | 1853 | same-strand | LysE type translocator |
| 10 | PF12146.10 | 1.0 | 4 | 3266 | same-strand | Serine aminopeptidase, S33 |
| 11 | PF00561.22 | 1.0 | 4 | 3266 | same-strand | alpha/beta hydrolase fold |
| 12 | PF12697.9 | 0.75 | 3 | 3266.0 | same-strand | Alpha/beta hydrolase family |
| 13 | PF08282.14 | 1.0 | 4 | 4296 | same-strand | haloacid dehalogenase-like hydrolase |
| 14 | PF00702.28 | 0.75 | 3 | 4296 | same-strand | haloacid dehalogenase-like hydrolase |
| 15 | PF10947.10 | 0.75 | 3 | 2944 | opposite-strand | Protein of unknown function (DUF2628) |
++ More..