Result : EXP00585
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00585 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4748993 |
| Right | 4749178 |
| Strand | - |
| Nucleotide Sequence | GTGTTTTTTTGTGGACTAATATCTGTTGCAAGGCTATGGGTTCGCACCTGCACTGGTTTATATCTCCGCCGTCGCGTTGATTGGCGCGCTCTCTTACATCCTGCTGGTGGGCGATGTGACGCGCGTTGGCTAATCTTTCAACTGTGGAATATGCGCCATACCACTGCGCATAATCCACTTTCTTAA |
| Sequence | VFFCGLISVARLWVRTCTGLYLRRRVDWRALLHPAGGRCDARWLIFQLWNMRHTTAHNPLS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 61 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4661494 | 4661679 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 4082313 | 4082498 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00011.23 | 1.0 | 2 | 3222.5 | same-strand | Hsp20/alpha crystallin family |
| 2 | PF07119.14 | 1.0 | 2 | 2322.0 | opposite-strand | Protein of unknown function (DUF1375) |
| 3 | PF12566.10 | 1.0 | 2 | 1109.0 | same-strand | Protein of unknown function (DUF3748) |
| 4 | PF08282.14 | 1.0 | 2 | 1206.0 | same-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF00702.28 | 1.0 | 2 | 1206.0 | same-strand | haloacid dehalogenase-like hydrolase |
++ More..