Result : EXP00583
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00583 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4604607 |
| Right | 4604816 |
| Strand | - |
| Nucleotide Sequence | ATGGGCAAATTAGGTGAAAACGTTCCGCTTCTTATCGATAAAGCCGTAGATTTCATGGCATCAAGCCAGGCGTTCCGGGAGTATCTGAAAAAACTTCCTCCCCGTAACGCGATTCCGTCCGGAATACCCGATGAAAGCGTGCCGTTATATCTACAACGTCTGGAGTATTATCGTCGGCTTTATCGGCCGAAGCAGGTAGAGGGGCAGTAA |
| Sequence | MGKLGENVPLLIDKAVDFMASSQAFREYLKKLPPRNAIPSGIPDESVPLYLQRLEYYRRLYRPKQVEGQ |
| Source of smORF | Ribo-seq |
| Function | The protein encoded by this ORF is under the control of the RNA Polymerase sigma factor RpoS which plays a role in general stress response. It is abundantly expressed in the stationary phase. Pubmed:28522802 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | Q57IE4 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3742064 | 3742273 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 3776171 | 3776380 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 4517108 | 4517317 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 103154 | 103366 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3732640 | 3732849 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 1716767 | 1716976 | - | NZ_CP053416.1 | Salmonella bongori |
| 7 | 3879161 | 3879370 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 8 | 4447105 | 4447314 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 9 | 3556540 | 3556746 | + | NZ_CP038469.1 | Citrobacter tructae |
| 10 | 2680638 | 2680847 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 11 | 2552883 | 2553089 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 12 | 2525175 | 2525381 | - | NZ_CP033744.1 | Citrobacter freundii |
| 13 | 307194 | 307400 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 14 | 1224124 | 1224330 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 15 | 4645064 | 4645273 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 16 | 4465494 | 4465688 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 17 | 195917 | 196126 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 18 | 162588 | 162812 | + | NZ_CP054254.1 | Klebsiella variicola |
| 19 | 152891 | 153115 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 20 | 5129853 | 5130077 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 21 | 614511 | 614729 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 22 | 212363 | 212587 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 23 | 153817 | 154041 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 24 | 154675 | 154899 | + | NZ_CP050508.1 | Raoultella terrigena |
| 25 | 160516 | 160740 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 26 | 53457 | 53681 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 27 | 4796950 | 4797168 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 28 | 145956 | 146162 | + | NZ_CP041247.1 | Raoultella electrica |
| 29 | 1561909 | 1562133 | - | NZ_CP026047.1 | Raoultella planticola |
| 30 | 4053947 | 4054156 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00529.22 | 0.76 | 22 | 4687 | same-strand | Cation efflux system protein CusB domain 1 |
| 2 | PF13533.8 | 0.76 | 22 | 4687 | same-strand | Biotin-lipoyl like |
| 3 | PF11742.10 | 0.76 | 22 | 4322 | same-strand | Protein of unknown function (DUF3302) |
| 4 | PF00359.24 | 0.93 | 27 | 1876.5 | opposite-strand | Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 |
| 5 | PF02378.20 | 0.93 | 27 | 1879.0 | opposite-strand | Phosphotransferase system, EIIC |
| 6 | PF02302.19 | 0.93 | 27 | 1877 | opposite-strand | PTS system, Lactose/Cellobiose specific IIB subunit |
| 7 | PF08125.15 | 0.93 | 27 | 599.0 | opposite-strand | Mannitol dehydrogenase C-terminal domain |
| 8 | PF01232.25 | 0.93 | 27 | 599.0 | opposite-strand | Mannitol dehydrogenase Rossmann domain |
| 9 | PF05068.14 | 0.93 | 27 | 12.0 | opposite-strand | Mannitol repressor |
| 10 | PF10928.10 | 0.97 | 28 | 276 | opposite-strand | Protein of unknown function (DUF2810) |
| 11 | PF02652.16 | 0.83 | 24 | 925 | opposite-strand | L-lactate permease |
| 12 | PF07729.14 | 0.9 | 26 | 2573 | opposite-strand | FCD domain |
| 13 | PF00392.23 | 0.86 | 25 | 2575.0 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 14 | PF01070.20 | 0.69 | 20 | 3344.5 | opposite-strand | FMN-dependent dehydrogenase |
++ More..