Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00582 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 4488696 |
Right | 4488989 |
Strand | + |
Nucleotide Sequence | ATGCAGATGCTGATTTCATTACCCCCGGTGATTACTAAAGGAGAGGCTAAAACGACTTTATTCCCCTGGTATGTGTATCCACCAGTAGAACCCTTCGTTGCCCGAATGCTGGCAGGAACTGTTGGCAGAACGGCAACATTTTTTTTGTCGTTGACCTCACCATGTCGATCACTATGCCTGTATCCCACCTTACTGGCTGACAACCCCACTATGCCGCTGGTCTGTAAATCCCTCATATCTCTCCTCGCGCGCAATTTAAAGAACCGTTATTTCTCAAGAATTTTCAGGGACTAA |
Sequence | MQMLISLPPVITKGEAKTTLFPWYVYPPVEPFVARMLAGTVGRTATFFLSLTSPCRSLCLYPTLLADNPTMPLVCKSLISLLARNLKNRYFSRIFRD |
Source of smORF | Ribo-seq |
Function | Transcriptionally upregulated in LB with nitrite, radish sprouts, spinach leaf juice, at 15 degree celsius. It is downregulated on exposure to antibiotics. Pubmed:26911138 |
Pubmed ID | 26911138 |
Domain | |
Functional Category | Manually curated function from literature |
Uniprot ID | |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3658937 | 3659230 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 4401197 | 4401490 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 334947 | 335240 | + | NZ_CP061527.1 | Shigella dysenteriae |
4 | 4152171 | 4152473 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 3623978 | 3624283 | + | NZ_AP014857.1 | Escherichia albertii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06411.13 | 1.0 | 4 | 2582 | opposite-strand | HdeA/HdeB family |
2 | PF03729.15 | 1.0 | 4 | 1370 | same-strand | Short repeat of unknown function (DUF308) |
3 | PF00196.21 | 1.0 | 4 | 44 | same-strand | Bacterial regulatory proteins, luxR family |
4 | PF16576.7 | 1.0 | 4 | 2 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
5 | PF00529.22 | 1.0 | 4 | 2 | same-strand | Cation efflux system protein CusB domain 1 |
6 | PF13437.8 | 1.0 | 4 | 2 | same-strand | HlyD family secretion protein |
7 | PF13533.8 | 1.0 | 4 | 2 | same-strand | Biotin-lipoyl like |
8 | PF00873.21 | 1.0 | 4 | 1184 | same-strand | AcrB/AcrD/AcrF family |
9 | PF12833.9 | 1.0 | 4 | 4663 | opposite-strand | Helix-turn-helix domain |
10 | PF00165.25 | 0.75 | 3 | 5757.5 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
11 | PF00282.21 | 0.75 | 3 | 6950 | opposite-strand | Pyridoxal-dependent decarboxylase conserved domain |