Result : EXP00582
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00582 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4488696 |
| Right | 4488989 |
| Strand | + |
| Nucleotide Sequence | ATGCAGATGCTGATTTCATTACCCCCGGTGATTACTAAAGGAGAGGCTAAAACGACTTTATTCCCCTGGTATGTGTATCCACCAGTAGAACCCTTCGTTGCCCGAATGCTGGCAGGAACTGTTGGCAGAACGGCAACATTTTTTTTGTCGTTGACCTCACCATGTCGATCACTATGCCTGTATCCCACCTTACTGGCTGACAACCCCACTATGCCGCTGGTCTGTAAATCCCTCATATCTCTCCTCGCGCGCAATTTAAAGAACCGTTATTTCTCAAGAATTTTCAGGGACTAA |
| Sequence | MQMLISLPPVITKGEAKTTLFPWYVYPPVEPFVARMLAGTVGRTATFFLSLTSPCRSLCLYPTLLADNPTMPLVCKSLISLLARNLKNRYFSRIFRD |
| Source of smORF | Ribo-seq |
| Function | Transcriptionally upregulated in LB with nitrite, radish sprouts, spinach leaf juice, at 15 degree celsius. It is downregulated on exposure to antibiotics. Pubmed:26911138 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3658937 | 3659230 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 4401197 | 4401490 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 334947 | 335240 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 4152171 | 4152473 | + | NZ_LR134340.1 | Escherichia marmotae |
| 5 | 3623978 | 3624283 | + | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06411.13 | 1.0 | 4 | 2582 | opposite-strand | HdeA/HdeB family |
| 2 | PF03729.15 | 1.0 | 4 | 1370 | same-strand | Short repeat of unknown function (DUF308) |
| 3 | PF00196.21 | 1.0 | 4 | 44 | same-strand | Bacterial regulatory proteins, luxR family |
| 4 | PF16576.7 | 1.0 | 4 | 2 | same-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 5 | PF00529.22 | 1.0 | 4 | 2 | same-strand | Cation efflux system protein CusB domain 1 |
| 6 | PF13437.8 | 1.0 | 4 | 2 | same-strand | HlyD family secretion protein |
| 7 | PF13533.8 | 1.0 | 4 | 2 | same-strand | Biotin-lipoyl like |
| 8 | PF00873.21 | 1.0 | 4 | 1184 | same-strand | AcrB/AcrD/AcrF family |
| 9 | PF12833.9 | 1.0 | 4 | 4663 | opposite-strand | Helix-turn-helix domain |
| 10 | PF00165.25 | 0.75 | 3 | 5757.5 | opposite-strand | Bacterial regulatory helix-turn-helix proteins, AraC family |
| 11 | PF00282.21 | 0.75 | 3 | 6950 | opposite-strand | Pyridoxal-dependent decarboxylase conserved domain |
++ More..