Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00578 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 4227781 |
Right | 4228050 |
Strand | + |
Nucleotide Sequence | TTGCGCTGCGGAAAAGGTGACATTGGCGCAACGAAGGTATATTTTGTTTTTTGCCGGAGGATAGCAGCAGATCGCTGCACAATGTCCGTCAAGTCTAACATTGACACTCTGGGGCAAAATAGACCGGCGTCCCGACCTGCTGGAATTTATCGCTATGCATACAGCTGTCGGGGCATACGCTTTACAGACGGCGGTGAAACGCCTGTCACAATCACACTAAACAAAGAGTACGGAACCCACTCATGGATATTCGTAAGATTAAAAAACTGA |
Sequence | LRCGKGDIGATKVYFVFCRRIAADRCTMSVKSNIDTLGQNRPASRPAGIYRYAYSCRGIRFTDGGETPVTITLNKEYGTHSWIFVRLKN |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 26911138 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 89 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 418234 | 418503 | - | NZ_CP061527.1 | Shigella dysenteriae |
2 | 3392765 | 3393034 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 3405194 | 3405463 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
4 | 4140282 | 4140551 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 3908534 | 3908806 | + | NZ_LR134340.1 | Escherichia marmotae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06325.15 | 0.75 | 3 | 3607.0 | same-strand | Ribosomal protein L11 methyltransferase (PrmA) |
2 | PF00474.19 | 1.0 | 4 | 2144 | same-strand | Sodium:solute symporter family |
3 | PF06196.14 | 1.0 | 4 | 1912 | same-strand | Protein of unknown function (DUF997) |
4 | PF02786.19 | 1.0 | 4 | 454 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
5 | PF00289.24 | 1.0 | 4 | 454 | same-strand | Biotin carboxylase, N-terminal domain |
6 | PF02785.21 | 1.0 | 4 | 454 | same-strand | Biotin carboxylase C-terminal domain |
7 | PF02655.16 | 1.0 | 4 | 454 | same-strand | ATP-grasp domain |
8 | PF02222.24 | 1.0 | 4 | 454 | same-strand | ATP-grasp domain |
9 | PF00364.24 | 1.0 | 4 | -27 | same-strand | Biotin-requiring enzyme |
10 | PF00107.28 | 1.0 | 4 | 736 | same-strand | Zinc-binding dehydrogenase |
11 | PF00563.22 | 1.0 | 4 | 1862 | opposite-strand | EAL domain |
12 | PF17157.6 | 1.0 | 4 | 1862 | opposite-strand | Gammaproteobacterial periplasmic sensor domain |
13 | PF00990.23 | 1.0 | 4 | 1862 | opposite-strand | Diguanylate cyclase, GGDEF domain |
14 | PF06723.15 | 1.0 | 4 | 4107 | opposite-strand | MreB/Mbl protein |
15 | PF14450.8 | 1.0 | 4 | 4107 | opposite-strand | Cell division protein FtsA |
16 | PF04085.16 | 0.75 | 3 | 5216.0 | opposite-strand | rod shape-determining protein MreC |