Result : EXP00578
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00578 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 4227781 |
| Right | 4228050 |
| Strand | + |
| Nucleotide Sequence | TTGCGCTGCGGAAAAGGTGACATTGGCGCAACGAAGGTATATTTTGTTTTTTGCCGGAGGATAGCAGCAGATCGCTGCACAATGTCCGTCAAGTCTAACATTGACACTCTGGGGCAAAATAGACCGGCGTCCCGACCTGCTGGAATTTATCGCTATGCATACAGCTGTCGGGGCATACGCTTTACAGACGGCGGTGAAACGCCTGTCACAATCACACTAAACAAAGAGTACGGAACCCACTCATGGATATTCGTAAGATTAAAAAACTGA |
| Sequence | LRCGKGDIGATKVYFVFCRRIAADRCTMSVKSNIDTLGQNRPASRPAGIYRYAYSCRGIRFTDGGETPVTITLNKEYGTHSWIFVRLKN |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 89 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 418234 | 418503 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 3392765 | 3393034 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 3405194 | 3405463 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 4140282 | 4140551 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3908534 | 3908806 | + | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP061527.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06325.15 | 0.75 | 3 | 3607.0 | same-strand | Ribosomal protein L11 methyltransferase (PrmA) |
| 2 | PF00474.19 | 1.0 | 4 | 2144 | same-strand | Sodium:solute symporter family |
| 3 | PF06196.14 | 1.0 | 4 | 1912 | same-strand | Protein of unknown function (DUF997) |
| 4 | PF02786.19 | 1.0 | 4 | 454 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 5 | PF00289.24 | 1.0 | 4 | 454 | same-strand | Biotin carboxylase, N-terminal domain |
| 6 | PF02785.21 | 1.0 | 4 | 454 | same-strand | Biotin carboxylase C-terminal domain |
| 7 | PF02655.16 | 1.0 | 4 | 454 | same-strand | ATP-grasp domain |
| 8 | PF02222.24 | 1.0 | 4 | 454 | same-strand | ATP-grasp domain |
| 9 | PF00364.24 | 1.0 | 4 | -27 | same-strand | Biotin-requiring enzyme |
| 10 | PF00107.28 | 1.0 | 4 | 736 | same-strand | Zinc-binding dehydrogenase |
| 11 | PF00563.22 | 1.0 | 4 | 1862 | opposite-strand | EAL domain |
| 12 | PF17157.6 | 1.0 | 4 | 1862 | opposite-strand | Gammaproteobacterial periplasmic sensor domain |
| 13 | PF00990.23 | 1.0 | 4 | 1862 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 14 | PF06723.15 | 1.0 | 4 | 4107 | opposite-strand | MreB/Mbl protein |
| 15 | PF14450.8 | 1.0 | 4 | 4107 | opposite-strand | Cell division protein FtsA |
| 16 | PF04085.16 | 0.75 | 3 | 5216.0 | opposite-strand | rod shape-determining protein MreC |
++ More..