Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00577 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 3938455 |
Right | 3938658 |
Strand | - |
Nucleotide Sequence | TTGCGCGAATTTTCTCCTCTCTGTACGGAGTTTGCCCGATGCACGCCATCTCCTTACATTCTCTCGCTTATCGCCGTTTCGCGCGAAACCCTTCTCTTTTTATGCTACTGCTCATGCGGTGAAGTTAACGCACGCTCACTGCAGGACAACAGTAAAATCAGAGCCTTTCTGCTTTTACTGATGTCTGGCGGTCGGAGCTGGTGA |
Sequence | LREFSPLCTEFARCTPSPYILSLIAVSRETLLFLCYCSCGEVNARSLQDNSKIRAFLLLLMSGGRSW |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 26911138 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 67 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3850956 | 3851159 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 727681 | 727884 | - | NZ_CP061527.1 | Shigella dysenteriae |
3 | 3051332 | 3051535 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 3109235 | 3109438 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
5 | 3274989 | 3275213 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF14815.8 | 1.0 | 4 | 5170 | opposite-strand | NUDIX domain |
2 | PF00730.27 | 1.0 | 4 | 5170 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
3 | PF00633.25 | 1.0 | 4 | 5170 | opposite-strand | Helix-hairpin-helix motif |
4 | PF10576.11 | 1.0 | 4 | 5170 | opposite-strand | Iron-sulfur binding domain of endonuclease III |
5 | PF04362.16 | 1.0 | 4 | 4867 | opposite-strand | Bacterial Fe(2+) trafficking |
6 | PF11873.10 | 1.0 | 4 | 3723 | opposite-strand | Membrane-bound lytic murein transglycosylase C, N-terminal domain |
7 | PF01464.22 | 1.0 | 4 | 3723 | opposite-strand | Transglycosylase SLT domain |
8 | PF03825.18 | 1.0 | 4 | 2265 | opposite-strand | Nucleoside H+ symporter |
9 | PF12832.9 | 1.0 | 4 | 2265 | opposite-strand | MFS 1 like family |
10 | PF01276.22 | 1.0 | 4 | 80 | same-strand | Orn/Lys/Arg decarboxylase, major domain |
11 | PF03711.17 | 1.0 | 4 | 80 | same-strand | Orn/Lys/Arg decarboxylase, C-terminal domain |
12 | PF03709.17 | 0.75 | 3 | 80.0 | same-strand | Orn/Lys/Arg decarboxylase, N-terminal domain |
13 | PF04474.14 | 0.75 | 3 | 115.0 | opposite-strand | Protein of unknown function (DUF554) |