Result : EXP00577
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00577 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 3938455 |
| Right | 3938658 |
| Strand | - |
| Nucleotide Sequence | TTGCGCGAATTTTCTCCTCTCTGTACGGAGTTTGCCCGATGCACGCCATCTCCTTACATTCTCTCGCTTATCGCCGTTTCGCGCGAAACCCTTCTCTTTTTATGCTACTGCTCATGCGGTGAAGTTAACGCACGCTCACTGCAGGACAACAGTAAAATCAGAGCCTTTCTGCTTTTACTGATGTCTGGCGGTCGGAGCTGGTGA |
| Sequence | LREFSPLCTEFARCTPSPYILSLIAVSRETLLFLCYCSCGEVNARSLQDNSKIRAFLLLLMSGGRSW |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 67 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3850956 | 3851159 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 727681 | 727884 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 3051332 | 3051535 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 3109235 | 3109438 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 3274989 | 3275213 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14815.8 | 1.0 | 4 | 5170 | opposite-strand | NUDIX domain |
| 2 | PF00730.27 | 1.0 | 4 | 5170 | opposite-strand | HhH-GPD superfamily base excision DNA repair protein |
| 3 | PF00633.25 | 1.0 | 4 | 5170 | opposite-strand | Helix-hairpin-helix motif |
| 4 | PF10576.11 | 1.0 | 4 | 5170 | opposite-strand | Iron-sulfur binding domain of endonuclease III |
| 5 | PF04362.16 | 1.0 | 4 | 4867 | opposite-strand | Bacterial Fe(2+) trafficking |
| 6 | PF11873.10 | 1.0 | 4 | 3723 | opposite-strand | Membrane-bound lytic murein transglycosylase C, N-terminal domain |
| 7 | PF01464.22 | 1.0 | 4 | 3723 | opposite-strand | Transglycosylase SLT domain |
| 8 | PF03825.18 | 1.0 | 4 | 2265 | opposite-strand | Nucleoside H+ symporter |
| 9 | PF12832.9 | 1.0 | 4 | 2265 | opposite-strand | MFS 1 like family |
| 10 | PF01276.22 | 1.0 | 4 | 80 | same-strand | Orn/Lys/Arg decarboxylase, major domain |
| 11 | PF03711.17 | 1.0 | 4 | 80 | same-strand | Orn/Lys/Arg decarboxylase, C-terminal domain |
| 12 | PF03709.17 | 0.75 | 3 | 80.0 | same-strand | Orn/Lys/Arg decarboxylase, N-terminal domain |
| 13 | PF04474.14 | 0.75 | 3 | 115.0 | opposite-strand | Protein of unknown function (DUF554) |
++ More..