Result : B1VAB0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S16 |
| NCBI Accession ID | AM422018.1 |
| Organism | Phytoplasma australiense |
| Left | 556340 |
| Right | 556615 |
| Strand | - |
| Nucleotide Sequence | ATGGCAATTAAAATGCGTTTACAACGTTTTGGAGTCCACAAAAGACCTTTTTATAGAGTAGTTGCAAGTGATTCCAGAGTTACTAGAGATGGTAAGTTTTTAGACATTGTAGGAACTTATGACACTATTTTAAACATTATTAAATTAGATAATGAAAAAGTCCAAAAATGGCTTTCTTGCGGTGCTCAACCAACTCAAACAGTTAAAAAAATCTTGAAAAAAAATTTTGTTTTTCAAAAAGACAATCAAATTAAAAAACCTCAAACTGCAAAATAA |
| Sequence | MAIKMRLQRFGVHKRPFYRVVASDSRVTRDGKFLDIVGTYDTILNIIKLDNEKVQKWLSCGAQPTQTVKKILKKNFVFQKDNQIKKPQTAK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00368. Profile Description: Ribosomal protein S16. This model describes ribosomal S16 of bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 18359806 |
| Domain | CDD:412339 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1VAB0 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 117
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 268653 | 268889 | + | NC_022538.1 | Acholeplasma palmae J233 |
| 2 | 1243810 | 1244052 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 3 | 1253411 | 1253653 | + | NZ_LR215050.1 | Acholeplasma hippikon |
| 4 | 1711296 | 1711538 | - | NZ_LR215048.1 | Acholeplasma axanthum |
| 5 | 1607271 | 1607522 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 6 | 2546670 | 2546915 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 7 | 2789733 | 2789981 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 8 | 1479389 | 1479634 | - | NC_022549.1 | Acholeplasma brassicae |
| 9 | 2527247 | 2527495 | - | NZ_CP028842.1 | Clostridium botulinum |
| 10 | 1573969 | 1574214 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 11 | 1713057 | 1713302 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 12 | 1951132 | 1951404 | + | NZ_CP012294.1 | Pediococcus damnosus |
| 13 | 2700641 | 2700913 | - | NZ_CP019870.1 | Clostridioides difficile |
| 14 | 3727529 | 3727774 | + | NC_020304.1 | Desulfocapsa sulfexigens DSM 10523 |
| 15 | 3258745 | 3258987 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 16 | 2890617 | 2890889 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 17 | 822000 | 822245 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 18 | 2761507 | 2761752 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 19 | 1303560 | 1303820 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 20 | 1307740 | 1308000 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 21 | 1281762 | 1282022 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 22 | 1419265 | 1419525 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 23 | 459992 | 460234 | + | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 24 | 1221728 | 1221970 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 25 | 3166165 | 3166410 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 26 | 1325391 | 1325636 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 27 | 2232953 | 2233198 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 28 | 766332 | 766604 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 29 | 1302378 | 1302623 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 30 | 2747011 | 2747268 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 31 | 774850 | 775092 | - | NZ_HF545616.1 | Ruminococcus bicirculans |
| 32 | 3088140 | 3088391 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 33 | 1309769 | 1310029 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 34 | 2268505 | 2268747 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 35 | 2617772 | 2618035 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 36 | 1145135 | 1145392 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 37 | 2009161 | 2009406 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 38 | 1706881 | 1707123 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 39 | 1041375 | 1041647 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 40 | 1338828 | 1339070 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 41 | 3160334 | 3160579 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 42 | 270247 | 270492 | + | NZ_CP070062.1 | Coprococcus comes |
| 43 | 27076 | 27345 | - | NZ_CP015994.1 | Anaplasma ovis str. Haibei |
| 44 | 851024 | 851266 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 45 | 1280337 | 1280582 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 46 | 1351561 | 1351806 | - | NZ_CP066014.1 | Anaerococcus vaginalis |
| 47 | 73251 | 73496 | - | NZ_CP067016.1 | Anaerococcus obesiensis |
| 48 | 1639759 | 1640025 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 49 | 4402178 | 4402444 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 50 | 1879313 | 1879555 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 51 | 1040747 | 1041019 | - | NZ_CP017326.1 | Weissella soli |
| 52 | 1653022 | 1653267 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 53 | 1449802 | 1450047 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 54 | 1786397 | 1786642 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 55 | 1022838 | 1023083 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 56 | 1072990 | 1073235 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 57 | 2431535 | 2431780 | + | NZ_CP039126.1 | Blautia producta |
| 58 | 3753640 | 3753885 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 59 | 1688663 | 1688908 | - | NZ_CP014204.2 | Clostridium baratii |
| 60 | 3194865 | 3195101 | - | NZ_CP034413.2 | Dysosmobacter welbionis |
| 61 | 1872404 | 1872649 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 62 | 1487224 | 1487469 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 63 | 38075 | 38344 | + | NC_012026.1 | Anaplasma marginale str. Florida |
| 64 | 28013 | 28282 | + | NC_013532.1 | Anaplasma centrale str. Israel |
| 65 | 860978 | 861223 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 66 | 3861799 | 3862065 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 67 | 3943249 | 3943515 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 68 | 2826218 | 2826475 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 69 | 1120943 | 1121188 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 70 | 2918717 | 2918983 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 71 | 2293333 | 2293578 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 72 | 2218014 | 2218256 | - | NZ_CP025286.1 | Ethanoligenens harbinense YUAN-3 |
| 73 | 1062206 | 1062451 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 74 | 2962791 | 2963036 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 75 | 1915761 | 1916003 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 76 | 1328351 | 1328596 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 77 | 1208218 | 1208460 | + | NZ_LN879430.1 | Herbinix luporum |
| 78 | 821612 | 821851 | - | NZ_CP029256.1 | Christensenella minuta |
| 79 | 705479 | 705727 | - | NC_020127.1 | Lawsonia intracellularis N343 |
| 80 | 1622207 | 1622452 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 81 | 985556 | 985828 | + | NZ_CP013213.1 | Erysipelothrix larvae |
| 82 | 1442448 | 1442705 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 83 | 2287928 | 2288173 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 84 | 3252571 | 3252837 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 85 | 535758 | 536006 | - | NC_015732.1 | Treponema caldarium DSM 7334 |
| 86 | 3741561 | 3741806 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 87 | 3239323 | 3239568 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 88 | 1433601 | 1433849 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 89 | 1646403 | 1646648 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 90 | 1181299 | 1181571 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 91 | 2526675 | 2526917 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 92 | 2905812 | 2906054 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 93 | 2083001 | 2083276 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 94 | 931685 | 931924 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 95 | 1166788 | 1167033 | - | NZ_CP016786.1 | Clostridium isatidis |
| 96 | 2204819 | 2205064 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 97 | 2619331 | 2619570 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 98 | 1402034 | 1402276 | + | NZ_CP031115.1 | Rubrobacter indicoceani |
| 99 | 3290567 | 3290812 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 100 | 565975 | 566214 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 101 | 211932 | 212168 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 102 | 3000715 | 3000954 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 103 | 253890 | 254135 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 104 | 3519490 | 3519744 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 105 | 1794264 | 1794503 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 106 | 2288754 | 2289020 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 107 | 1362803 | 1363084 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 108 | 1127275 | 1127514 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 109 | 1547192 | 1547473 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 110 | 842152 | 842391 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 111 | 2795304 | 2795552 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 112 | 4299739 | 4299984 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 113 | 2208415 | 2208660 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 114 | 2673388 | 2673633 | - | NC_014624.2 | Eubacterium callanderi |
| 115 | 3103001 | 3103246 | + | NZ_CP019962.1 | Eubacterium limosum |
| 116 | 3136205 | 3136444 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 117 | 4043633 | 4043872 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP036523.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13083.8 | 0.97 | 113 | 26 | same-strand | KH domain |
| 2 | PF01782.20 | 0.91 | 107 | 332 | same-strand | RimM N-terminal domain |
| 3 | PF05239.18 | 0.87 | 102 | 332.0 | same-strand | PRC-barrel domain |
| 4 | PF01746.23 | 0.88 | 103 | 844 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 5 | PF01245.22 | 0.77 | 90 | 1764.5 | same-strand | Ribosomal protein L19 |
| 6 | PF00448.24 | 0.88 | 103 | 75 | same-strand | SRP54-type protein, GTPase domain |
| 7 | PF02978.21 | 0.88 | 103 | 56 | same-strand | Signal peptide binding domain |
| 8 | PF02881.21 | 0.88 | 103 | 75 | same-strand | SRP54-type protein, helical bundle domain |
++ More..