Result : EXP00576
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00576 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 3915171 |
| Right | 3915311 |
| Strand | - |
| Nucleotide Sequence | ATGTTATACCCATCTCGGCGCTTCTCAGGATTCAAGAGCTGGTTACAGTTACTGAGGACTGAACAAGGGCGCTCTTGTAAAAACAAGAGTTTTCTCGTGGTTTCGCCGAACTGTCACACTTACGTTCGGTTATGTGCTTAA |
| Sequence | MLYPSRRFSGFKSWLQLLRTEQGRSCKNKSFLVVSPNCHTYVRLCA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3827672 | 3827812 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3024348 | 3024488 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 704488 | 704628 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3086059 | 3086199 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 3027084 | 3027224 | - | NZ_AP014857.1 | Escherichia albertii |
| 6 | 3569646 | 3569786 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00491.23 | 0.8 | 4 | 3137 | same-strand | Arginase family |
| 2 | PF02784.18 | 1.0 | 5 | 148.0 | same-strand | Pyridoxal-dependent decarboxylase, pyridoxal binding domain |
| 3 | PF17810.3 | 1.0 | 5 | 148.0 | same-strand | Arginine decarboxylase helical bundle domain |
| 4 | PF17944.3 | 1.0 | 5 | 148.0 | same-strand | Arginine decarboxylase C-terminal helical extension |
| 5 | PF02773.18 | 1.0 | 5 | 507.0 | opposite-strand | S-adenosylmethionine synthetase, C-terminal domain |
| 6 | PF02772.18 | 1.0 | 5 | 507.0 | opposite-strand | S-adenosylmethionine synthetase, central domain |
| 7 | PF00438.22 | 1.0 | 5 | 507.0 | opposite-strand | S-adenosylmethionine synthetase, N-terminal domain |
| 8 | PF00083.26 | 1.0 | 5 | 2098.0 | opposite-strand | Sugar (and other) transporter |
| 9 | PF10263.11 | 0.8 | 4 | 3611 | opposite-strand | SprT-like family |
| 10 | PF17283.4 | 1.0 | 5 | 3611.0 | opposite-strand | SprT-like zinc ribbon domain |
| 11 | PF04231.15 | 1.0 | 5 | 4161.0 | opposite-strand | Endonuclease I |
++ More..