Result : EXP00575
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00575 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 3288738 |
| Right | 3288869 |
| Strand | - |
| Nucleotide Sequence | ATGTTCTGGTACAGTCGCTCAAATGTACTCCGGATACACGGTTCGCTGATTTCCAGGACATTGTCGTCATTCTGCGACCTGTCCCGTGTATCACGGGCCTGCGAATTCATCAAGGAATGCATTGCGGAGTGA |
| Sequence | MFWYSRSNVLRIHGSLISRTLSSFCDLSRVSRACEFIKECIAE |
| Source of smORF | Ribo-seq |
| Function | Transcriptionally downregulated at pH9, LB with nitrite and pH4. It is upregulated in the presence of Acanthamoeba. Pubmed:26911138 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 43 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3201867 | 3201998 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1257663 | 1257794 | + | NZ_CP061527.1 | Shigella dysenteriae |
++ More..