Result : EXP00574
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00574 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 3278637 |
| Right | 3278807 |
| Strand | - |
| Nucleotide Sequence | TTGCCTTTTTCTGTTTCTATAGAATCAAGTAGCCTACAGGGCGGCGATTACCAGGCTATGATCAAATCAGCAAATCAGGGCGTCTGGACATCAGTTGACGTGCTGTTACAATCGCCCACACCTAAACAGGCGGATACGGTATCGTTCCGTCATGGATGGCAAACTGCATAA |
| Sequence | LPFSVSIESSSLQGGDYQAMIKSANQGVWTSVDVLLQSPTPKQADTVSFRHGWQTA |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1259174 | 1259344 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 2475332 | 2475502 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 2465033 | 2465203 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 3191766 | 3191936 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 5 | 3000812 | 3000982 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 2465023 | 2465193 | - | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01226.19 | 0.8 | 4 | 98 | opposite-strand | Formate/nitrite transporter |
| 2 | PF04333.15 | 1.0 | 5 | 26.0 | same-strand | MlaA lipoprotein |
| 3 | PF03349.18 | 1.0 | 5 | 2479.5 | opposite-strand | Outer membrane protein transport protein (OMPP1/FadL/TodX) |
| 4 | PF04175.14 | 0.8 | 4 | 4099 | same-strand | Protein of unknown function (DUF406) |
| 5 | PF13356.8 | 0.6 | 3 | 1342.0 | opposite-strand | Arm DNA-binding domain |
| 6 | PF14659.8 | 0.6 | 3 | 1342.0 | opposite-strand | Phage integrase, N-terminal SAM-like domain |
| 7 | PF00108.25 | 0.6 | 3 | 3797.0 | same-strand | Thiolase, N-terminal domain |
| 8 | PF02803.20 | 0.6 | 3 | 3797.0 | same-strand | Thiolase, C-terminal domain |
++ More..