Result : EXP00573
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00573 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 3030492 |
| Right | 3030746 |
| Strand | + |
| Nucleotide Sequence | ATGCAGACAATCATCTATCAGATAACCCCCAGCAAATGGTGTACGGAGAGAGTCCTTATTGCATCAACAGGGCTAAAGCCCGGCACCATCGAGCGGGCCAGAAGAAAGTCATGGATGCAGGGAAAAGAATACCGCCATTACGCTGTAGAAGGTGATCCTGGGCATTACAGTGAATGCCTGTACAACATCGAAGAAATTATGCGATGGATCGAAAACCAGAAACAACCAGGTGCCAAAAATGCAAGTTCCGGTTAA |
| Sequence | MQTIIYQITPSKWCTERVLIASTGLKPGTIERARRKSWMQGKEYRHYAVEGDPGHYSECLYNIEEIMRWIENQKQPGAKNASSG |
| Source of smORF | Ribo-seq |
| Function | The ORF matches to the profile of pfam06806. Profile Description: Putative excisionase (DUF1233). This family consists of several putative phage excisionase proteins of around 80 residues in length. |
| Pubmed ID | 26911138 |
| Domain | CDD:399649 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2942308 | 2942562 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2254046 | 2254297 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 963968 | 964210 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 4 | 1099568 | 1099816 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 5 | 2463791 | 2464036 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 6 | 1632460 | 1632684 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 7 | 2723313 | 2723546 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 8 | 1476772 | 1477023 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 9 | 3250957 | 3251187 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 10 | 2638404 | 2638637 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 11 | 2909488 | 2909697 | + | NC_015968.1 | Enterobacter soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12167.10 | 1.0 | 8 | 46.0 | same-strand | Arm DNA-binding domain |
| 2 | PF00589.24 | 1.0 | 8 | 46.0 | same-strand | Phage integrase family |
++ More..