Result : EXP00558
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00558 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 2499278 |
| Right | 2499436 |
| Strand | + |
| Nucleotide Sequence | TTGATGCCTGTCCCTTTTGTTACACTCCGTTATCACGCACAAGAGATATGCAGGACACTGGTATGCCGACTAAACGCTTTGATAAAAAACACTGGAAGATGGTGGTGGTGCTACTGGCAATCTGTGGCGCTATGTTGTTGCTACGTTGGGCAGCAATGA |
| Sequence | LMPVPFVTLRYHAQEICRTLVCRLNALIKNTGRWWWCYWQSVALCCCYVGQQ |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 52 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2404954 | 2405112 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1805103 | 1805261 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 3 | 1541539 | 1541697 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00707.24 | 1.0 | 2 | 4574 | opposite-strand | Translation initiation factor IF-3, C-terminal domain |
| 2 | PF00587.27 | 1.0 | 2 | 2534 | opposite-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 3 | PF03129.22 | 1.0 | 2 | 2534 | opposite-strand | Anticodon binding domain |
| 4 | PF07973.16 | 1.0 | 2 | 2534 | opposite-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 5 | PF02824.23 | 1.0 | 2 | 2534 | opposite-strand | TGS domain |
| 6 | PF04338.14 | 1.0 | 2 | 64 | opposite-strand | Protein of unknown function, DUF481 |
| 7 | PF00294.26 | 1.0 | 2 | 1109 | same-strand | pfkB family carbohydrate kinase |
| 8 | PF11080.10 | 1.0 | 2 | 2139 | same-strand | Endoribonuclease GhoS |
| 9 | PF03881.16 | 1.0 | 2 | 2535 | same-strand | Fructosamine kinase |
| 10 | PF01636.25 | 1.0 | 2 | 2535 | same-strand | Phosphotransferase enzyme family |
++ More..