Result : EXP00556
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00556 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 2398680 |
| Right | 2398832 |
| Strand | + |
| Nucleotide Sequence | TTGTCGTTTCAGTCATTCTTCTTGGCGTGGCGAGTCACATTGACAACTATCAGCCACCTGAACAGAGTACTACGGTACAACACAAGTAAGCCCTGCGCTTGTAGAGCGACATGCTGCCCGTCAGGGTGCATGTTTTCACTTGTCGGATATTAA |
| Sequence | LSFQSFFLAWRVTLTTISHLNRVLRYNTSKPCACRATCCPSGCMFSLVGY |
| Source of smORF | Ribo-seq |
| Function | It might be required for colonisation of host(cattle) as is inferred by transposon or STM studies. Pubmed:26911138 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2304356 | 2304508 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1918579 | 1918731 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 1704588 | 1704740 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 1681306 | 1681458 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02378.20 | 0.67 | 2 | 3643 | same-strand | Phosphotransferase system, EIIC |
| 2 | PF00367.22 | 0.67 | 2 | 3643 | same-strand | phosphotransferase system, EIIB |
| 3 | PF00155.23 | 1.0 | 3 | 2461.0 | same-strand | Aminotransferase class I and II |
| 4 | PF00962.24 | 1.0 | 3 | 1356.0 | same-strand | Adenosine deaminase |
| 5 | PF02894.19 | 1.0 | 3 | 280.0 | opposite-strand | Oxidoreductase family, C-terminal alpha/beta domain |
| 6 | PF01408.24 | 1.0 | 3 | 280.0 | opposite-strand | Oxidoreductase family, NAD-binding Rossmann fold |
| 7 | PF05321.13 | 1.0 | 3 | 209.0 | same-strand | Haemolysin expression modulating protein |
| 8 | PF10754.11 | 0.67 | 2 | 510 | same-strand | Protein of unknown function (DUF2569) |
| 9 | PF02508.16 | 1.0 | 3 | 1027.0 | same-strand | Rnf-Nqr subunit, membrane protein |
| 10 | PF14697.8 | 1.0 | 3 | 1608 | same-strand | 4Fe-4S dicluster domain |
| 11 | PF00037.29 | 1.0 | 3 | 1608.0 | same-strand | 4Fe-4S binding domain |
| 12 | PF04060.15 | 1.0 | 3 | 1608.0 | same-strand | Putative Fe-S cluster |
| 13 | PF12797.9 | 1.0 | 3 | 1608.0 | same-strand | 4Fe-4S binding domain |
| 14 | PF12837.9 | 1.0 | 3 | 1608.0 | same-strand | 4Fe-4S binding domain |
| 15 | PF13187.8 | 1.0 | 3 | 1889.5 | same-strand | 4Fe-4S dicluster domain |
| 16 | PF13237.8 | 1.0 | 3 | 1889.5 | same-strand | 4Fe-4S dicluster domain |
| 17 | PF01512.19 | 1.0 | 3 | 2179.0 | same-strand | Respiratory-chain NADH dehydrogenase 51 Kd subunit |
| 18 | PF13375.8 | 1.0 | 3 | 2179.0 | same-strand | RnfC Barrel sandwich hybrid domain |
| 19 | PF10531.11 | 1.0 | 3 | 2179.0 | same-strand | SLBB domain |
| 20 | PF12838.9 | 1.0 | 3 | 2179.0 | same-strand | 4Fe-4S dicluster domain |
| 21 | PF13183.8 | 1.0 | 3 | 2179.0 | same-strand | 4Fe-4S dicluster domain |
| 22 | PF13534.8 | 1.0 | 3 | 2179.0 | same-strand | 4Fe-4S dicluster domain |
| 23 | PF00532.23 | 0.67 | 2 | 5409.0 | opposite-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 24 | PF00356.23 | 0.67 | 2 | 5409.0 | opposite-strand | Bacterial regulatory proteins, lacI family |
| 25 | PF13407.8 | 0.67 | 2 | 5409.0 | opposite-strand | Periplasmic binding protein domain |
| 26 | PF13377.8 | 0.67 | 2 | 5409.0 | opposite-strand | Periplasmic binding protein-like domain |
++ More..