Result : EXP00554
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00554 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 2177578 |
| Right | 2177796 |
| Strand | - |
| Nucleotide Sequence | TTGCAGGTGAATGCAACGTCAAGCGATGGGCGTTGCGCTCCATATTGTCTTACTTCCTTTTTTGAATTACTGCATAGCACAATTGATTCGTACGACGCCGACTTTGATGAGTCGGCTTTTTTTTGCCTGTTATTTATCAGCGTCTACCCTTTAAGAGTCCACCCAATGACCGGAGGGAAATATGACGACACTTATTTATTTGCAAATTCCTGTCCCTGA |
| Sequence | LQVNATSSDGRCAPYCLTSFFELLHSTIDSYDADFDESAFFCLLFISVYPLRVHPMTGGKYDDTYLFANSCP |
| Source of smORF | Ribo-seq |
| Function | Transcriptionally upregulated in spinach leaf juice and downregulated at acidic pH. Pubmed:26911138 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1865779 | 1865997 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 2 | 1918736 | 1918954 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 2291873 | 2292091 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 1409127 | 1409345 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 2348657 | 2348869 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 1449734 | 1449946 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3927727 | 3927924 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 8 | 2066365 | 2066613 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 9 | 2639885 | 2640109 | - | NZ_CP038498.1 | Pectobacterium punjabense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01171.22 | 1.0 | 8 | 1634 | opposite-strand | PP-loop family |
| 2 | PF00270.31 | 0.62 | 5 | 166.0 | same-strand | DEAD/DEAH box helicase |
| 3 | PF00271.33 | 0.75 | 6 | 166 | same-strand | Helicase conserved C-terminal domain |
| 4 | PF03880.17 | 0.75 | 6 | 166 | same-strand | DbpA RNA binding domain |
| 5 | PF04851.17 | 0.62 | 5 | 166.0 | same-strand | Type III restriction enzyme, res subunit |
| 6 | PF01544.20 | 1.0 | 8 | 94 | same-strand | CorA-like Mg2+ transporter protein |
| 7 | PF00990.23 | 0.62 | 5 | 1339.5 | opposite-strand | Diguanylate cyclase, GGDEF domain |
| 8 | PF08448.12 | 0.62 | 5 | 1335.5 | opposite-strand | PAS fold |
| 9 | PF13426.9 | 0.62 | 5 | 1335.5 | opposite-strand | PAS domain |
++ More..