Protein Information |
Information Type | Description |
---|---|
Protein name | Sec-independent protein translocase protein TatA |
NCBI Accession ID | CP001001.1 |
Organism | Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1) |
Left | 2900916 |
Right | 2901188 |
Strand | - |
Nucleotide Sequence | ATGGGCAGCATGAGTATCTGGCACTGGGTCATCGTCGCGGTCATCGTGATGCTGCTGTTCGGACGCGGCAAGGTGTCCGACCTGATGGGCGACGTCGCGAAGGGCATCAAAGCCTTCAAGAAGGGCATGGCCGAGGACGAGACGCCGCCGGCGGTCCAGGCCGCGCCGCCCCCGGCCGAGCCGGTCCGCACCATCCCGCACGCTACCGAGACGAGCCCCGGAACCGCGATCCCGGCGAGCCATCTCCCCGGCGGCGAGCGCAAGCCGGTCTGA |
Sequence | MGSMSIWHWVIVAVIVMLLFGRGKVSDLMGDVAKGIKAFKKGMAEDETPPAVQAAPPPAEPVRTIPHATETSPGTAIPASHLPGGERKPV |
Source of smORF | Swiss-Prot |
Function | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. {ECO:0000255|HAMAP-Rule:MF_00236}. |
Pubmed ID | |
Domain | CDD:294511 |
Functional Category | Others |
Uniprot ID | B1M332 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2900916 | 2901188 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
2 | 2357901 | 2358173 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
3 | 3147328 | 3147600 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
4 | 2885279 | 2885551 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
5 | 6257269 | 6257562 | - | NZ_CP029550.1 | Methylobacterium durans |
6 | 3540620 | 3540895 | + | NZ_CP039546.1 | Methylorubrum populi |
7 | 1846362 | 1846601 | + | NZ_CP045423.1 | Microvirga thermotolerans |
8 | 2294930 | 2295202 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
9 | 4121693 | 4121932 | + | NZ_CP016428.1 | Bradyrhizobium icense |
10 | 4527106 | 4527348 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
11 | 4101041 | 4101274 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
12 | 4841008 | 4841253 | - | NZ_CP017147.1 | Bosea vaviloviae |
13 | 1550454 | 1550699 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
14 | 1949634 | 1949870 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
15 | 1987530 | 1987757 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
16 | 4167729 | 4167956 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
17 | 4094654 | 4094875 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
18 | 3423685 | 3423906 | - | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
19 | 4146990 | 4147211 | + | NZ_CP033507.1 | Mesorhizobium jarvisii |
20 | 3649512 | 3649733 | + | NZ_CP033361.1 | Mesorhizobium erdmanii |
21 | 907612 | 907833 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
22 | 4531168 | 4531425 | + | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
23 | 1967791 | 1968009 | - | NC_014217.1 | Starkeya novella DSM 506 |
24 | 638312 | 638560 | - | NC_011666.1 | Methylocella silvestris BL2 |
25 | 435560 | 435799 | - | NZ_CP046908.1 | Stappia indica |
26 | 2574173 | 2574391 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
27 | 2731060 | 2731281 | + | NZ_CP018171.1 | Mesorhizobium oceanicum |
28 | 2563510 | 2563746 | + | NZ_CP072611.1 | Aureimonas populi |
29 | 4486432 | 4486653 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
30 | 445904 | 446152 | - | NZ_CP020083.1 | Blastomonas fulva |
31 | 1853861 | 1854079 | - | NZ_LT605585.1 | Brucella inopinata |
32 | 3763916 | 3764140 | + | NZ_CP071454.1 | Rhizobium lentis |
33 | 1437948 | 1438172 | + | NZ_HG938353.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
34 | 1534667 | 1534894 | + | NZ_CP017940.1 | Phyllobacterium zundukense |
35 | 372387 | 372638 | - | NZ_LN606600.1 | Acetobacter senegalensis |
36 | 1370580 | 1370837 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
37 | 3350676 | 3350912 | + | NZ_AP017655.1 | Sphingobium cloacae |
38 | 928213 | 928443 | + | NZ_CP054836.1 | Oricola thermophila |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00902.20 | 0.95 | 36 | 664.0 | same-strand | Sec-independent protein translocase protein (TatC) |
2 | PF00933.23 | 0.89 | 34 | 1796.5 | same-strand | Glycosyl hydrolase family 3 N terminal domain |
3 | PF05036.15 | 0.84 | 32 | 2950.0 | same-strand | SPOR domain |
4 | PF05746.17 | 0.63 | 24 | 4353.0 | same-strand | DALR anticodon binding domain |
5 | PF03485.18 | 0.63 | 24 | 4353.0 | same-strand | Arginyl tRNA synthetase N terminal domain |
6 | PF00587.27 | 0.66 | 25 | 1636 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
7 | PF02403.24 | 0.66 | 25 | 1636 | same-strand | Seryl-tRNA synthetase N-terminal domain |
8 | PF04079.18 | 0.71 | 27 | 181 | same-strand | Segregation and condensation complex subunit ScpB |