Result : EXP00548
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00548 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 1894665 |
| Right | 1894886 |
| Strand | + |
| Nucleotide Sequence | ATGGAGGATAAAATGCCAAACAAAAAAAGAAATCCGCTTATTGAAAAACAGATTGAATGCCTGGTAAATCAACTCAGGCAATCAGGGTTATTAAAAACTCATTCAGAGTTGAGGCTCACAGAATCAGCATTCGACGATAAATTAAATAATGTCCTTTATAATGGCATTATTGATTTTAATCGTTCTGTTGGTCGCCGCGGCCCTGCTGGTGTTTCCTTATAA |
| Sequence | MEDKMPNKKRNPLIEKQIECLVNQLRQSGLLKTHSELRLTESAFDDKLNNVLYNGIIDFNRSVGRRGPAGVSL |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2015401 | 2015622 | - | NZ_AP014857.1 | Escherichia albertii |
| 2 | 2201033 | 2201254 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14549.8 | 1.0 | 2 | 1643.5 | same-strand | DNA-binding transcriptional regulator Cro |
| 2 | PF07151.14 | 1.0 | 2 | 651.0 | opposite-strand | Protein of unknown function (DUF1391) |
++ More..