Result : EXP00544
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00544 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 1766742 |
| Right | 1766924 |
| Strand | + |
| Nucleotide Sequence | GTGACAGAGCCATTGCCCATGATAGTGCCCATTAAAAGGATGGACACTATTTCCCCGGAACCTGAACTCACCGCACAGGCGTTCTACATAAAACGCTTACGCTTCATTGTTGACTCGAACTCGACTTCAGATAAATCACGCTTCACCCTTGATGCAGATTCGGGTTCATGTTCAGAATGTTGA |
| Sequence | VTEPLPMIVPIKRMDTISPEPELTAQAFYIKRLRFIVDSNSTSDKSRFTLDADSGSCSEC |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 60 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1681693 | 1681875 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2469166 | 2469348 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 1223725 | 1223907 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 1240034 | 1240201 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06450.14 | 0.67 | 2 | 5317 | opposite-strand | Bacterial Na+/H+ antiporter B (NhaB) |
| 2 | PF07840.14 | 1.0 | 3 | 4377.0 | same-strand | FadR C-terminal domain |
| 3 | PF00392.23 | 1.0 | 3 | 4377.0 | same-strand | Bacterial regulatory proteins, gntR family |
| 4 | PF07729.14 | 1.0 | 3 | 4377.0 | same-strand | FCD domain |
| 5 | PF04293.15 | 1.0 | 3 | 2793.0 | opposite-strand | SpoVR like protein |
| 6 | PF01266.26 | 1.0 | 3 | 1165.0 | same-strand | FAD dependent oxidoreductase |
| 7 | PF01168.22 | 0.67 | 2 | 85 | same-strand | Alanine racemase, N-terminal domain |
| 8 | PF00842.23 | 1.0 | 3 | 85.5 | same-strand | Alanine racemase, C-terminal domain |
| 9 | PF00999.23 | 1.0 | 3 | 1030.0 | opposite-strand | Sodium/hydrogen exchanger family |
| 10 | PF02080.23 | 1.0 | 3 | 1030.0 | opposite-strand | TrkA-C domain |
| 11 | PF03471.19 | 1.0 | 3 | 1030.0 | opposite-strand | Transporter associated domain |
| 12 | PF17676.3 | 1.0 | 3 | 2861.0 | opposite-strand | LD-carboxypeptidase C-terminal domain |
| 13 | PF02016.17 | 1.0 | 3 | 2861.0 | opposite-strand | LD-carboxypeptidase N-terminal domain |
| 14 | PF01464.22 | 1.0 | 3 | 3851.5 | same-strand | Transglycosylase SLT domain |
++ More..