Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00544 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 1766742 |
Right | 1766924 |
Strand | + |
Nucleotide Sequence | GTGACAGAGCCATTGCCCATGATAGTGCCCATTAAAAGGATGGACACTATTTCCCCGGAACCTGAACTCACCGCACAGGCGTTCTACATAAAACGCTTACGCTTCATTGTTGACTCGAACTCGACTTCAGATAAATCACGCTTCACCCTTGATGCAGATTCGGGTTCATGTTCAGAATGTTGA |
Sequence | VTEPLPMIVPIKRMDTISPEPELTAQAFYIKRLRFIVDSNSTSDKSRFTLDADSGSCSEC |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 26911138 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1681693 | 1681875 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 2469166 | 2469348 | - | NZ_CP061527.1 | Shigella dysenteriae |
3 | 1223725 | 1223907 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
4 | 1240034 | 1240201 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06450.14 | 0.67 | 2 | 5317 | opposite-strand | Bacterial Na+/H+ antiporter B (NhaB) |
2 | PF07840.14 | 1.0 | 3 | 4377.0 | same-strand | FadR C-terminal domain |
3 | PF00392.23 | 1.0 | 3 | 4377.0 | same-strand | Bacterial regulatory proteins, gntR family |
4 | PF07729.14 | 1.0 | 3 | 4377.0 | same-strand | FCD domain |
5 | PF04293.15 | 1.0 | 3 | 2793.0 | opposite-strand | SpoVR like protein |
6 | PF01266.26 | 1.0 | 3 | 1165.0 | same-strand | FAD dependent oxidoreductase |
7 | PF01168.22 | 0.67 | 2 | 85 | same-strand | Alanine racemase, N-terminal domain |
8 | PF00842.23 | 1.0 | 3 | 85.5 | same-strand | Alanine racemase, C-terminal domain |
9 | PF00999.23 | 1.0 | 3 | 1030.0 | opposite-strand | Sodium/hydrogen exchanger family |
10 | PF02080.23 | 1.0 | 3 | 1030.0 | opposite-strand | TrkA-C domain |
11 | PF03471.19 | 1.0 | 3 | 1030.0 | opposite-strand | Transporter associated domain |
12 | PF17676.3 | 1.0 | 3 | 2861.0 | opposite-strand | LD-carboxypeptidase C-terminal domain |
13 | PF02016.17 | 1.0 | 3 | 2861.0 | opposite-strand | LD-carboxypeptidase N-terminal domain |
14 | PF01464.22 | 1.0 | 3 | 3851.5 | same-strand | Transglycosylase SLT domain |