Result : EXP00543
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00543 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 1682381 |
| Right | 1682569 |
| Strand | - |
| Nucleotide Sequence | ATGCAGGACAACACAATGACCGATAAAGAATTGACCAAAACATTATCACCGGCACGGAAAAGACGGCGCAGAAAGATAGAGCATGAATCAGAAAGATTCGCACCATGTGCTTTTGCCCTTGAGCAATTCCTTAAAGAGTACAGGGAAAAGCGCTCATTGCAGGTATGGCAACGAACTGAACCAGACTGA |
| Sequence | MQDNTMTDKELTKTLSPARKRRRRKIEHESERFAPCAFALEQFLKEYREKRSLQVWQRTEPD |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1596943 | 1597131 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 1177006 | 1177182 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 921781 | 921981 | - | NZ_LR134340.1 | Escherichia marmotae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01546.30 | 0.67 | 2 | 3476.0 | opposite-strand | Peptidase family M20/M25/M40 |
| 2 | PF07687.16 | 0.67 | 2 | 3476.0 | opposite-strand | Peptidase dimerisation domain |
| 3 | PF08007.14 | 0.67 | 2 | 2306.0 | same-strand | Cupin superfamily protein |
| 4 | PF00589.24 | 1.0 | 3 | 833 | opposite-strand | Phage integrase family |
| 5 | PF13356.8 | 1.0 | 3 | 1715 | opposite-strand | Arm DNA-binding domain |
| 6 | PF13973.8 | 0.67 | 2 | 1202.5 | opposite-strand | Domain of unknown function (DUF4222) |
++ More..