Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00538 |
NCBI Accession ID | CP008957.1 |
Organism | Escherichia coli O157:H7 str. EDL933 |
Left | 1254787 |
Right | 1255074 |
Strand | - |
Nucleotide Sequence | ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACCGGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCGAACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAGATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA |
Sequence | MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIEIVSVTHSRRQFPFSI |
Source of smORF | Ribo-seq |
Function | The ORF matches to the profile of cl21503. Profile Description: ParE toxin of type II toxin-antitoxin system, parDE. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604. |
Pubmed ID | 26911138 |
Domain | CDD:419697 |
Functional Category | Conserved domain based functional assignment |
Uniprot ID | |
ORF Length (Amino Acid) | 95 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1167456 | 1167743 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
2 | 2249244 | 2249522 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
3 | 51292 | 51579 | + | NZ_LR134529.1 | Bartonella vinsonii |
4 | 1774891 | 1775178 | - | NZ_CP031844.2 | Bartonella krasnovii |
5 | 2114241 | 2114528 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
6 | 324337 | 324633 | - | NZ_AP014568.1 | Serpentinomonas raichei |
7 | 4782809 | 4783108 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
8 | 2064905 | 2065189 | + | NZ_CP048812.1 | Halomonas socia |
9 | 1139717 | 1139992 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
10 | 2016 | 2309 | + | NZ_CP067023.1 | Pseudomonas cannabina pv. alisalensis |
11 | 626860 | 627141 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
12 | 696240 | 696515 | + | NZ_CP022111.1 | Nitrospirillum amazonense CBAmc |
13 | 2533378 | 2533653 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
14 | 2433213 | 2433488 | + | NZ_CP030126.1 | Indioceanicola profundi |
15 | 477172 | 477447 | - | NZ_CP046293.1 | Yersinia intermedia |
16 | 2009373 | 2009618 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
17 | 2095349 | 2095624 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
18 | 3613347 | 3613622 | - | NZ_LT907988.1 | Orrella dioscoreae |