ProsmORF-pred
Result : EXP00538
Protein Information
Information Type Description
Protein name EXP00538
NCBI Accession ID CP008957.1
Organism Escherichia coli O157:H7 str. EDL933
Left 1254787
Right 1255074
Strand -
Nucleotide Sequence ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACCGGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCGAACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAGATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA
Sequence MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIEIVSVTHSRRQFPFSI
Source of smORF Ribo-seq
Function The ORF matches to the profile of cl21503. Profile Description: ParE toxin of type II toxin-antitoxin system, parDE. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.
Pubmed ID 26911138
Domain CDD:419697
Functional Category Conserved domain based functional assignment
Uniprot ID
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 17
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1167456 1167743 - NC_002695.2 Escherichia coli O157:H7 str. Sakai
2 2249244 2249522 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
3 51292 51579 + NZ_LR134529.1 Bartonella vinsonii
4 1774891 1775178 - NZ_CP031844.2 Bartonella krasnovii
5 2114241 2114528 + NC_010161.1 Bartonella tribocorum CIP 105476
6 324337 324633 - NZ_AP014568.1 Serpentinomonas raichei
7 4782809 4783108 + NC_008786.1 Verminephrobacter eiseniae EF01-2
8 2064905 2065189 + NZ_CP048812.1 Halomonas socia
9 1139717 1139992 - NZ_CP014158.1 Pseudomonas citronellolis
10 2016 2309 + NZ_CP067023.1 Pseudomonas cannabina pv. alisalensis
11 626860 627141 - NZ_CP019240.1 Rhodoferax antarcticus
12 696240 696515 + NZ_CP022111.1 Nitrospirillum amazonense CBAmc
13 2533378 2533653 + NZ_CP022987.1 Pusillimonas thiosulfatoxidans
14 2433213 2433488 + NZ_CP030126.1 Indioceanicola profundi
15 477172 477447 - NZ_CP046293.1 Yersinia intermedia
16 2009373 2009618 - NZ_AP014569.1 Serpentinomonas mccroryi
17 2095349 2095624 - NZ_CP023422.1 Janthinobacterium svalbardensis
18 3613347 3613622 - NZ_LT907988.1 Orrella dioscoreae
++ More..