| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00538 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 1254787 |
| Right | 1255074 |
| Strand | - |
| Nucleotide Sequence | ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACCGGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCGAACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAGATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA |
| Sequence | MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIEIVSVTHSRRQFPFSI |
| Source of smORF | Ribo-seq |
| Function | The ORF matches to the profile of cl21503. Profile Description: ParE toxin of type II toxin-antitoxin system, parDE. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604. |
| Pubmed ID | 26911138 |
| Domain | CDD:419697 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | |
| ORF Length (Amino Acid) | 95 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1167456 | 1167743 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 2249244 | 2249522 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 51292 | 51579 | + | NZ_LR134529.1 | Bartonella vinsonii |
| 4 | 1774891 | 1775178 | - | NZ_CP031844.2 | Bartonella krasnovii |
| 5 | 2114241 | 2114528 | + | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 6 | 324337 | 324633 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 7 | 4782809 | 4783108 | + | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 8 | 2064905 | 2065189 | + | NZ_CP048812.1 | Halomonas socia |
| 9 | 1139717 | 1139992 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 10 | 2016 | 2309 | + | NZ_CP067023.1 | Pseudomonas cannabina pv. alisalensis |
| 11 | 626860 | 627141 | - | NZ_CP019240.1 | Rhodoferax antarcticus |
| 12 | 696240 | 696515 | + | NZ_CP022111.1 | Nitrospirillum amazonense CBAmc |
| 13 | 2533378 | 2533653 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 14 | 2433213 | 2433488 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 15 | 477172 | 477447 | - | NZ_CP046293.1 | Yersinia intermedia |
| 16 | 2009373 | 2009618 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 17 | 2095349 | 2095624 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 18 | 3613347 | 3613622 | - | NZ_LT907988.1 | Orrella dioscoreae |