Result : EXP00536

Protein Information

• Protein name: EXP00536
• NCBI Accession ID: CP008957.1
• Organism: Escherichia coli O157:H7 str. EDL933
• Left: 1144981
• Right: 1145136
• Strand: -
• Nucleotide Sequence: ATGTTTTCGGCACATTTCTCCCCAGAGTGTTATAATTGCGGTCGCAGAGTTGGTTACGCTCATTACCCCGCTGCCGATAAGGAATTTTTCGCGTCAGGTAACGCCCATCGTTTATCTCACCGCTCCCTTATACGTTGCGCTTTTGGTGCGGCTTAG
• Sequence: MFSAHFSPECYNCGRRVGYAHYPAADKEFFASGNAHRLSHRSLIRCAFGAA
• Source of smORF: Ribo-seq
• Function: Transcriptionally upregulated in minimal medium, pH9, radish sprouts, spinach leaf juice, at 15 degree celsius, in presence of Acanthamoeba, agar surface and acidic pH. Pubmed:26911138
• Pubmed ID: 26911138
• Functional Category: Manually curated function from literature
• ORF Length (Amino Acid): 51

Conservation Analysis

No. of Species: 6

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1057650	1057805	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
2	926572	926727	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
3	877944	878099	-	NC_004337.2	Shigella flexneri 2a str. 301
4	1423374	1423529	-	NZ_CP061527.1	Shigella dysenteriae
5	4561817	4561972	-	NZ_CP057657.1	Escherichia fergusonii
6	1590812	1590967	-	NZ_LR134340.1	Escherichia marmotae
7	952185	952340	-	NZ_AP014857.1	Escherichia albertii

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002695.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF12704.9	0.83	5	4309.5	opposite-strand	MacB-like periplasmic core domain
2	PF00005.29	1.0	6	2469.0	same-strand	ABC transporter
3	PF02687.23	0.83	5	4309.5	opposite-strand	FtsX-like permease family
4	PF00313.24	0.83	5	4012.5	same-strand	'Cold-shock' DNA-binding domain
5	PF02617.19	0.83	5	3369.5	opposite-strand	ATP-dependent Clp protease adaptor protein ClpS
6	PF07724.16	0.83	5	1062.5	opposite-strand	AAA domain (Cdc48 subfamily)
7	PF17871.3	0.83	5	1062.5	opposite-strand	AAA lid domain
8	PF10431.11	0.83	5	1062.5	opposite-strand	C-terminal, D2-small domain, of ClpB protein
9	PF00004.31	0.83	5	1062.5	opposite-strand	ATPase family associated with various cellular activities (AAA)
10	PF07728.16	0.83	5	1062.5	opposite-strand	AAA domain (dynein-related subfamily)
11	PF02861.22	0.83	5	1062.5	opposite-strand	Clp amino terminal domain, pathogenicity island component
12	PF05621.13	0.83	5	1062.5	opposite-strand	Bacterial TniB protein
13	PF01176.21	1.0	6	129	same-strand	Translation initiation factor 1A / IF-1
14	PF03588.16	1.0	6	1	same-strand	Leucyl/phenylalanyl-tRNA protein transferase
15	PF00664.25	1.0	6	1609.5	same-strand	ABC transporter transmembrane region
16	PF13401.8	1.0	6	747	same-strand	AAA domain
17	PF13191.8	1.0	6	747	same-strand	AAA ATPase domain
18	PF07992.16	1.0	6	4358	same-strand	Pyridine nucleotide-disulphide oxidoreductase
19	PF00070.29	1.0	6	4358	same-strand	Pyridine nucleotide-disulphide oxidoreductase
20	PF01037.23	1.0	6	5868	opposite-strand	Lrp/AsnC ligand binding domain
21	PF13412.8	1.0	6	5868	opposite-strand	Winged helix-turn-helix DNA-binding
22	PF13404.8	1.0	6	5868	opposite-strand	AsnC-type helix-turn-helix domain