Result : EXP00534
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00534 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 976722 |
| Right | 976862 |
| Strand | - |
| Nucleotide Sequence | TTGCAATCCCCTTCGCAAAAGATTTGTTCGTCAGTAGTTGACCTGAACTGCGGCTCGCTCTATCTTCTTGCAGCCCTGCGTATATTGCGGCTCGCGGATGCGGACCCCTTTCCCCTCTTCACGCACTCTTGCAGGTATTGA |
| Sequence | LQSPSQKICSSVVDLNCGSLYLLAALRILRLADADPFPLFTHSCRY |
| Source of smORF | Ribo-seq |
| Function | Transcriptionally upregulated at pH9 and when grown in presence of Acanthamoeba castellanii. Pubmed:26911138 |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 976952 | 977092 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 796706 | 796846 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 3 | 852645 | 852785 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 4 | 2886587 | 2886727 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 5 | 93381 | 93521 | - | NZ_CP038469.1 | Citrobacter tructae |
| 6 | 732791 | 732931 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 7 | 3971477 | 3971620 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 8 | 1497024 | 1497164 | - | NZ_LR134340.1 | Escherichia marmotae |
| 9 | 1450934 | 1451077 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 10 | 4379195 | 4379335 | - | NZ_CP033744.1 | Citrobacter freundii |
| 11 | 3996208 | 3996345 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 12 | 1519347 | 1519490 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 13 | 1540371 | 1540514 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 14 | 3077296 | 3077433 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 15 | 901578 | 901718 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 16 | 844896 | 845033 | - | NZ_AP014857.1 | Escherichia albertii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP044098.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00497.22 | 0.87 | 13 | 4641.0 | same-strand | Bacterial extracellular solute-binding proteins, family 3 |
| 2 | PF00210.26 | 1.0 | 15 | 3763.0 | same-strand | Ferritin-like domain |
| 3 | PF00892.22 | 1.0 | 15 | 2581.0 | same-strand | EamA-like transporter family |
| 4 | PF13505.8 | 1.0 | 15 | 1698.5 | opposite-strand | Outer membrane protein beta-barrel domain |
| 5 | PF00884.25 | 1.0 | 15 | 47.5 | same-strand | Sulfatase |
| 6 | PF01325.21 | 1.0 | 15 | 403.5 | opposite-strand | Iron dependent repressor, N-terminal DNA binding domain |
| 7 | PF03600.18 | 0.93 | 14 | 874 | opposite-strand | Citrate transporter |
| 8 | PF17969.3 | 0.67 | 10 | 2046 | same-strand | L,D-transpeptidase C-terminal domain |
| 9 | PF03734.16 | 0.67 | 10 | 2046 | same-strand | L,D-transpeptidase catalytic domain |
| 10 | PF00005.29 | 0.6 | 9 | 3183.0 | opposite-strand | ABC transporter |
| 11 | PF12848.9 | 0.6 | 9 | 3183.0 | opposite-strand | ABC transporter |
| 12 | PF02742.17 | 0.6 | 9 | 405 | opposite-strand | Iron dependent repressor, metal binding and dimerisation domain |
++ More..