Result : EXP00530
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00530 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 713265 |
| Right | 713417 |
| Strand | + |
| Nucleotide Sequence | ATGTTGGCGAATGTTGGCATGGCGCCGTGGGTTCCCCCTCACCCTAACCCTCTCCCCGATGGGGCGAGGGGGCTGACCGAGCGCGTTGATAGCATTTGTAGGCCGGATAAGGCGTTCACGCCGCATCCGGCACTCTTTCAGCAACATGGTTAG |
| Sequence | MLANVGMAPWVPPHPNPLPDGARGLTERVDSICRPDKAFTPHPALFQQHG |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 26911138 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 713488 | 713640 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 2 | 3097086 | 3097238 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 535380 | 535532 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 632018 | 632170 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002695.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 0.67 | 2 | 4337 | same-strand | AMP-binding enzyme |
| 2 | PF13193.8 | 0.67 | 2 | 4337 | same-strand | AMP-binding enzyme C-terminal domain |
| 3 | PF00857.22 | 1.0 | 3 | 3466.0 | same-strand | Isochorismatase family |
| 4 | PF00550.27 | 1.0 | 3 | 3466.0 | same-strand | Phosphopantetheine attachment site |
| 5 | PF13561.8 | 1.0 | 3 | 2720.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 6 | PF00106.27 | 1.0 | 3 | 2720.0 | same-strand | short chain dehydrogenase |
| 7 | PF03061.24 | 1.0 | 3 | 2304.0 | same-strand | Thioesterase superfamily |
| 8 | PF02554.16 | 1.0 | 3 | 18.5 | same-strand | Carbon starvation protein CstA |
| 9 | PF13722.8 | 0.67 | 2 | 18 | same-strand | 5TM C-terminal transporter carbon starvation CstA |
| 10 | PF04328.15 | 1.0 | 3 | 12.0 | same-strand | Selenoprotein, putative |
| 11 | PF00465.21 | 1.0 | 3 | 219.0 | opposite-strand | Iron-containing alcohol dehydrogenase |
| 12 | PF13685.8 | 1.0 | 3 | 219.0 | opposite-strand | Iron-containing alcohol dehydrogenase |
| 13 | PF00155.23 | 1.0 | 3 | 1416.0 | same-strand | Aminotransferase class I and II |
| 14 | PF02195.20 | 0.67 | 2 | 2577 | opposite-strand | ParB-like nuclease domain |
++ More..