Result : EXP00527
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00527 |
| NCBI Accession ID | CP008957.1 |
| Organism | Escherichia coli O157:H7 str. EDL933 |
| Left | 217270 |
| Right | 217488 |
| Strand | - |
| Nucleotide Sequence | GTGCTGACAGGAGGGCATGTGGAAAAATATTGTGAGTTAATACGCAAGCGGTACGCGGAAATCGCCAGCGGAGACTTAGGATACGTTCCGGACGCGCTGGGCTGCGTTTTGAAAGTGCTGAATGAAATGGCTGCCGACGACGCCCTTTCTGAGGCTGTCAGGGAAAAAGCAGCATACGCTGCGGCAAACTTACTGGTGAGCGATTATGTCAATGAATGA |
| Sequence | VLTGGHVEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSEAVREKAAYAAANLLVSDYVNE |
| Source of smORF | Ribo-seq |
| Function | The ORF matches to the profile of cl23916. Profile Description: Uncharacterized protein family (UPF0253). hypothetical protein; Provisional |
| Pubmed ID | 26911138 |
| Domain | CDD:420090 |
| Functional Category | Conserved domain based functional assignment |
| Uniprot ID | Q87MC1 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 167
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3399142 | 3399360 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 836635 | 836853 | - | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 3769168 | 3769386 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 4 | 204869 | 205087 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 213925 | 214143 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 6 | 216704 | 216904 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 217270 | 217488 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 8 | 2940165 | 2940383 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 9 | 2570712 | 2570912 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 10 | 233909 | 234127 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 11 | 2437556 | 2437774 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 2867509 | 2867727 | - | NZ_CP053416.1 | Salmonella bongori |
| 13 | 4684308 | 4684526 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 14 | 280295 | 280513 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 15 | 2458418 | 2458636 | + | NZ_CP038469.1 | Citrobacter tructae |
| 16 | 1386088 | 1386306 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 17 | 3671785 | 3672003 | - | NZ_CP033744.1 | Citrobacter freundii |
| 18 | 3716093 | 3716293 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
| 19 | 4614926 | 4615126 | + | NZ_CP050508.1 | Raoultella terrigena |
| 20 | 4185290 | 4185490 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 21 | 4953716 | 4953916 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 22 | 929000 | 929200 | - | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 23 | 992277 | 992477 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 24 | 4500651 | 4500851 | + | NZ_CP054254.1 | Klebsiella variicola |
| 25 | 2733763 | 2733963 | - | NZ_CP026047.1 | Raoultella planticola |
| 26 | 4501459 | 4501659 | + | NZ_CP046672.1 | Raoultella ornithinolytica |
| 27 | 4226824 | 4227024 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 28 | 4840207 | 4840425 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 29 | 2006075 | 2006275 | - | NZ_CP020388.1 | Pluralibacter gergoviae |
| 30 | 2178946 | 2179146 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 31 | 4388444 | 4388644 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 32 | 699092 | 699292 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 33 | 2157516 | 2157734 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 34 | 915857 | 916075 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 35 | 902498 | 902698 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 36 | 4299639 | 4299839 | + | NZ_CP041247.1 | Raoultella electrica |
| 37 | 4920665 | 4920883 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 38 | 3645715 | 3645933 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 39 | 3134253 | 3134453 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 40 | 907788 | 907988 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 41 | 3901864 | 3902064 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 42 | 4293247 | 4293447 | - | NZ_CP023529.1 | Lelliottia amnigena |
| 43 | 3269092 | 3269292 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 44 | 3730371 | 3730571 | + | NZ_CP045845.1 | Kluyvera intermedia |
| 45 | 2528232 | 2528432 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 46 | 4010519 | 4010719 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 47 | 3769868 | 3770047 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 48 | 3256065 | 3256265 | + | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 49 | 886706 | 886906 | - | NZ_AP022508.1 | Enterobacter bugandensis |
| 50 | 855123 | 855323 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
| 51 | 869326 | 869526 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
| 52 | 1645729 | 1645929 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 53 | 899758 | 899958 | - | NZ_CP009756.1 | Enterobacter cloacae |
| 54 | 1015714 | 1015914 | - | NZ_CP043318.1 | Enterobacter chengduensis |
| 55 | 856257 | 856457 | - | NC_015968.1 | Enterobacter soli |
| 56 | 2653726 | 2653926 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 57 | 900825 | 901025 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 58 | 3409789 | 3409989 | - | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 59 | 3732759 | 3732941 | + | NZ_LR134201.1 | Cedecea lapagei |
| 60 | 4018021 | 4018203 | + | NZ_CP023525.1 | Cedecea neteri |
| 61 | 3635283 | 3635483 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 62 | 2218782 | 2218982 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 63 | 3291483 | 3291683 | + | NZ_CP045720.1 | Pantoea eucalypti |
| 64 | 926609 | 926809 | - | NZ_LN907827.1 | Erwinia gerundensis |
| 65 | 619323 | 619505 | + | NZ_CP019706.1 | Pantoea alhagi |
| 66 | 829657 | 829857 | - | NZ_CP034035.1 | Brenneria rubrifaciens |
| 67 | 3229182 | 3229382 | + | NZ_CP038853.1 | Pantoea vagans |
| 68 | 513422 | 513622 | + | NZ_CP047495.1 | Pectobacterium brasiliense |
| 69 | 3664552 | 3664752 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
| 70 | 3846799 | 3846999 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 71 | 1266665 | 1266865 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 72 | 3133 | 3333 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 73 | 815094 | 815294 | - | NZ_CP034148.1 | Pantoea agglomerans |
| 74 | 4226559 | 4226759 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 75 | 1427241 | 1427441 | + | NZ_CP011078.1 | Yersinia ruckeri |
| 76 | 955425 | 955607 | - | NZ_CP061511.1 | Mixta calida |
| 77 | 1061992 | 1062174 | - | NZ_CP026377.1 | Mixta gaviniae |
| 78 | 181971 | 182153 | - | NZ_CP028271.1 | Mixta intestinalis |
| 79 | 1206461 | 1206661 | - | NZ_CP038498.1 | Pectobacterium punjabense |
| 80 | 449362 | 449562 | - | NZ_CP015749.1 | Pectobacterium parmentieri |
| 81 | 3086967 | 3087167 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 82 | 1824480 | 1824680 | + | NZ_CP009787.1 | Yersinia rohdei |
| 83 | 62688 | 62888 | + | NZ_CP054043.1 | Yersinia mollaretii ATCC 43969 |
| 84 | 1146777 | 1146977 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 85 | 214206 | 214406 | + | NZ_CP007230.1 | Yersinia similis |
| 86 | 3041939 | 3042139 | + | NZ_CP014137.1 | Brenneria goodwinii |
| 87 | 4598974 | 4599156 | - | NZ_CP067057.1 | Rahnella aceris |
| 88 | 996627 | 996827 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 89 | 903145 | 903345 | - | NZ_CP046293.1 | Yersinia intermedia |
| 90 | 3605652 | 3605852 | + | NZ_CP032487.1 | Yersinia hibernica |
| 91 | 999683 | 999883 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 92 | 1677625 | 1677825 | + | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 93 | 4107036 | 4107236 | + | NZ_LT906479.1 | Serratia ficaria |
| 94 | 3405430 | 3405630 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 95 | 4097381 | 4097581 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 96 | 3610865 | 3611065 | + | NZ_CP043727.1 | Yersinia canariae |
| 97 | 4154008 | 4154208 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 98 | 1019504 | 1019704 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 99 | 3645688 | 3645888 | + | NC_017554.1 | Pantoea ananatis PA13 |
| 100 | 4180476 | 4180676 | + | NZ_LR134494.1 | Serratia quinivorans |
| 101 | 3450660 | 3450860 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 102 | 3585557 | 3585757 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 103 | 1173654 | 1173854 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
| 104 | 1083303 | 1083503 | - | NZ_CP025799.1 | Dickeya zeae |
| 105 | 2274247 | 2274447 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 106 | 3590372 | 3590572 | + | NZ_CP050150.1 | Hafnia alvei |
| 107 | 3704993 | 3705175 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
| 108 | 998600 | 998800 | - | NZ_CP065534.1 | Lonsdalea populi |
| 109 | 1005010 | 1005210 | - | NZ_CP071320.1 | Serratia ureilytica |
| 110 | 3108172 | 3108372 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 111 | 899396 | 899596 | - | NZ_CP029185.2 | Limnobaculum parvum |
| 112 | 3752785 | 3752985 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 113 | 1144161 | 1144361 | - | NZ_CP031560.1 | Dickeya dianthicola |
| 114 | 3253474 | 3253674 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
| 115 | 1163872 | 1164072 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 116 | 1652778 | 1652978 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 117 | 849144 | 849344 | + | NZ_CP023706.1 | Edwardsiella tarda |
| 118 | 866479 | 866679 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 119 | 377381 | 377581 | + | NZ_CP011254.1 | Serratia fonticola |
| 120 | 335522 | 335722 | + | NZ_CP065640.1 | Serratia rubidaea |
| 121 | 3047785 | 3047985 | + | NZ_LR134531.1 | Pragia fontium |
| 122 | 3296959 | 3297162 | + | NZ_LT615367.1 | Dickeya aquatica |
| 123 | 2575140 | 2575340 | - | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 124 | 2034222 | 2034422 | - | NZ_CP023009.1 | Lonsdalea britannica |
| 125 | 780338 | 780538 | - | NZ_LS483470.1 | Leminorella richardii |
| 126 | 3744920 | 3745120 | - | NZ_CP049115.1 | Pantoea stewartii |
| 127 | 749004 | 749210 | - | NZ_CP047475.1 | Vibrio astriarenae |
| 128 | 759974 | 760153 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 129 | 1997446 | 1997649 | + | NZ_CP033078.1 | Vibrio zhugei |
| 130 | 2562125 | 2562328 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 131 | 800597 | 800776 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 132 | 1252158 | 1252364 | - | NC_013456.1 | Vibrio antiquarius |
| 133 | 825038 | 825244 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 134 | 1952944 | 1953120 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 135 | 468447 | 468626 | - | NZ_AP019657.1 | Vibrio ponticus |
| 136 | 2442719 | 2442925 | + | NZ_CP030788.1 | Vibrio campbellii |
| 137 | 2695903 | 2696109 | - | NZ_CP019959.1 | Vibrio owensii |
| 138 | 703697 | 703876 | - | NZ_AP018689.1 | Vibrio aphrogenes |
| 139 | 625417 | 625596 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 140 | 967510 | 967713 | - | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 141 | 839467 | 839673 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 142 | 995902 | 996108 | - | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 143 | 2567084 | 2567290 | + | NZ_AP014635.1 | Vibrio tritonius |
| 144 | 1162260 | 1162460 | - | NZ_CP007445.1 | Gilliamella apicola |
| 145 | 646140 | 646322 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 146 | 2980627 | 2980809 | + | NZ_CP009467.1 | Vibrio harveyi |
| 147 | 1001364 | 1001546 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
| 148 | 594592 | 594795 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 149 | 1535608 | 1535811 | + | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 150 | 2011847 | 2012050 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 151 | 536949 | 537131 | + | NZ_CP014056.2 | Grimontia hollisae |
| 152 | 2206458 | 2206637 | + | NZ_AP019651.1 | Vibrio taketomensis |
| 153 | 698342 | 698521 | - | NZ_CP040021.1 | Salinivibrio kushneri |
| 154 | 1005904 | 1006107 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 155 | 750645 | 750851 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 156 | 3116753 | 3116959 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 157 | 1461963 | 1462169 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 158 | 1303038 | 1303214 | - | NZ_CP040990.1 | Vibrio furnissii |
| 159 | 731052 | 731255 | - | NZ_CP044060.1 | Aeromonas veronii |
| 160 | 469803 | 470009 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 161 | 1542375 | 1542584 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 162 | 975682 | 975891 | - | NZ_CP046268.1 | Vibrio spartinae |
| 163 | 768228 | 768404 | - | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 164 | 2538306 | 2538482 | + | NC_011753.2 | Vibrio atlanticus |
| 165 | 4358495 | 4358698 | + | NZ_LS483250.1 | Moritella yayanosii |
| 166 | 678666 | 678842 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 167 | 484097 | 484276 | - | NZ_CP035688.1 | Vibrio metoecus |
| 168 | 786322 | 786525 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014857.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00587.27 | 0.76 | 127 | 1946.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 2 | PF04073.17 | 0.76 | 127 | 1946.0 | same-strand | Aminoacyl-tRNA editing domain |
| 3 | PF03129.22 | 0.76 | 127 | 1946.0 | same-strand | Anticodon binding domain |
| 4 | PF04170.14 | 0.65 | 108 | 1195 | opposite-strand | NlpE N-terminal domain |
| 5 | PF00472.22 | 0.6 | 101 | 739.0 | opposite-strand | RF-1 domain |
| 6 | PF07152.14 | 0.71 | 118 | 207 | opposite-strand | YaeQ protein |
| 7 | PF07073.14 | 0.75 | 125 | -13.0 | same-strand | Modulator of Rho-dependent transcription termination (ROF) |
| 8 | PF01171.22 | 0.78 | 130 | 339 | opposite-strand | PP-loop family |
| 9 | PF11734.10 | 0.78 | 130 | 339 | opposite-strand | TilS substrate C-terminal domain |
| 10 | PF09179.13 | 0.77 | 129 | 336.0 | opposite-strand | TilS substrate binding domain |
| 11 | PF00903.27 | 0.66 | 110 | 1659 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 12 | PF13669.8 | 0.65 | 109 | 1659.0 | opposite-strand | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 13 | PF01980.18 | 0.65 | 109 | 3773 | same-strand | tRNA-methyltransferase O |
| 14 | PF18389.3 | 0.65 | 109 | 3773 | same-strand | TrmO C-terminal domain |
++ More..