Result : EXP00526
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00526 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 4472393 |
| Right | 4472512 |
| Strand | - |
| Nucleotide Sequence | ATGATAAGTAAAACGGAACCTATCAATAACACACGGGTAATCGCATCCACATCCAGCCAGCAGGCGATGATGACGCCCAGCAATACCGCGAGGCTTTCCTGGCGAAACGCCGCTTCGTGA |
| Sequence | MISKTEPINNTRVIASTSSQQAMMTPSNTARLSWRNAAS |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4458867 | 4458986 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 2206891 | 2207010 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 2034349 | 2034468 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 4 | 911767 | 911868 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 5 | 292273 | 292374 | - | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 5110044 | 5110163 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 3745432 | 3745551 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 8 | 4256735 | 4256854 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 9 | 4332927 | 4333046 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 10 | 3343002 | 3343103 | + | NZ_CP028271.1 | Mixta intestinalis |
| 11 | 760140 | 760241 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 12 | 4214003 | 4214122 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 13 | 4911381 | 4911500 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 14 | 305886 | 306005 | - | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 15 | 5198044 | 5198163 | + | NZ_CP054254.1 | Klebsiella variicola |
| 16 | 233690 | 233809 | - | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 17 | 3451491 | 3451595 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 18 | 3479130 | 3479234 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 19 | 5805460 | 5805579 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 20 | 398013 | 398114 | - | NZ_CP011118.1 | Yersinia enterocolitica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07148.14 | 0.74 | 14 | 4329.0 | opposite-strand | Maltose operon periplasmic protein precursor (MalM) |
| 2 | PF04345.15 | 1.0 | 19 | 3662.0 | opposite-strand | Chorismate lyase |
| 3 | PF01040.20 | 1.0 | 19 | 2776.0 | opposite-strand | UbiA prenyltransferase family |
| 4 | PF01553.23 | 1.0 | 19 | 240.0 | same-strand | Acyltransferase |
| 5 | PF01219.21 | 1.0 | 19 | -119.0 | opposite-strand | Prokaryotic diacylglycerol kinase |
| 6 | PF00717.25 | 0.95 | 18 | 274 | opposite-strand | Peptidase S24-like |
| 7 | PF01726.18 | 0.95 | 18 | 274 | opposite-strand | LexA DNA binding domain |
| 8 | PF01554.20 | 0.79 | 15 | 957.5 | opposite-strand | MatE |
| 9 | PF05532.14 | 0.95 | 18 | 2439 | opposite-strand | CsbD-like |
| 10 | PF01475.21 | 0.95 | 18 | 2715 | same-strand | Ferric uptake regulator family |
++ More..