Result : EXP00523

Protein Information

• Protein name: EXP00523
• NCBI Accession ID: NC_016856.1
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
• Left: 4097698
• Right: 4097835
• Strand: -
• Nucleotide Sequence: GTGGATAAATCTGGTGGAAAGCTTGGATCAACCGGTAGTTATCCAAAGAATAACCGTTGTTCACTTTTTGAGTTGTGTATAAGTACCCGTTTTGATCCCAGCTTATACGGACCACGATCACCGATCATTCACAGCTAG
• Sequence: VDKSGGKLGSTGSYPKNNRCSLFELCISTRFDPSLYGPRSPIIHS
• Source of smORF: Ribo-seq
• Pubmed ID: 28122954
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 45

Conservation Analysis

No. of Species: 26

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	4084018	4084155	-	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	3395833	3395970	+	NZ_CP038469.1	Citrobacter tructae
3	1889413	1889550	-	NZ_CP053416.1	Salmonella bongori
4	4232937	4233074	+	NC_013716.1	Citrobacter rodentium ICC168
5	77731	77868	-	NC_009792.1	Citrobacter koseri ATCC BAA-895
6	3892736	3892873	-	NZ_AP014857.1	Escherichia albertii
7	487575	487712	-	NZ_CP045205.1	Citrobacter telavivensis
8	4719420	4719557	-	NC_002695.2	Escherichia coli O157:H7 str. Sakai
9	3933118	3933255	-	NC_004337.2	Shigella flexneri 2a str. 301
10	3925851	3925988	-	NC_000913.3	Escherichia coli str. K-12 substr. MG1655
11	4251192	4251329	-	NZ_CP061527.1	Shigella dysenteriae
12	2846890	2847027	+	NZ_CP057657.1	Escherichia fergusonii
13	1184982	1185119	+	NZ_LT556085.1	Citrobacter amalonaticus
14	4417122	4417232	+	NZ_LR134340.1	Escherichia marmotae
15	5155640	5155798	+	NZ_LR134475.1	Klebsiella aerogenes
16	11	169	+	NZ_CP026377.1	Mixta gaviniae
17	4621584	4621724	+	NC_012880.1	Musicola paradisiaca Ech703
18	1080915	1081052	+	NZ_CP023009.1	Lonsdalea britannica
19	68887	69024	-	NZ_CP038853.1	Pantoea vagans
20	66564	66701	-	NZ_CP045720.1	Pantoea eucalypti
21	5384811	5384948	+	NZ_CP014007.2	Kosakonia oryzae
22	3883220	3883357	-	NC_010694.1	Erwinia tasmaniensis Et1/99
23	60102	60239	-	NZ_CP034148.1	Pantoea agglomerans
24	4320491	4320652	+	NZ_CP015581.1	Tatumella citrea
25	3938098	3938256	+	NZ_LR134531.1	Pragia fontium
26	3790136	3790273	+	NZ_CP065534.1	Lonsdalea populi
27	743526	743666	+	NZ_CP029736.1	Providencia rettgeri

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_013716.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00137.23	1.0	26	4690	same-strand	ATP synthase subunit C
2	PF00119.22	1.0	26	3832	same-strand	ATP synthase A chain
3	PF03899.17	1.0	26	3438	same-strand	ATP synthase I chain
4	PF02527.17	1.0	26	2173	same-strand	rRNA small subunit methyltransferase G
5	PF01134.24	1.0	26	218	same-strand	Glucose inhibited division protein A
6	PF13932.8	1.0	26	218	same-strand	tRNA modifying enzyme MnmG/GidA C-terminal domain
7	PF00258.27	0.92	24	24	same-strand	Flavodoxin
8	PF01037.23	0.92	24	558	same-strand	Lrp/AsnC ligand binding domain
9	PF13412.8	0.92	24	558	same-strand	Winged helix-turn-helix DNA-binding
10	PF13404.8	0.92	24	558	same-strand	AsnC-type helix-turn-helix domain
11	PF03590.17	0.65	17	1167.0	opposite-strand	Aspartate-ammonia ligase
12	PF13519.8	0.88	23	2164.0	same-strand	von Willebrand factor type A domain
13	PF20030.1	0.92	24	3609	same-strand	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
14	PF07728.16	0.92	24	3609	same-strand	AAA domain (dynein-related subfamily)
15	PF17868.3	0.92	24	3609	same-strand	AAA lid domain
16	PF12592.10	0.92	24	3609	same-strand	Protein of unknown function (DUF3763)
17	PF07726.13	0.77	20	3609	same-strand	ATPase family associated with various cellular activities (AAA)