Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00501 |
NCBI Accession ID | NC_016856.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
Left | 1759667 |
Right | 1759849 |
Strand | - |
Nucleotide Sequence | ATGAGCTGTCTTTTGACCTTATTATATCTACACTCGTCCTTGTCGGACCCGATTCCCACTGACCCTGTTCCCATTCCTGAGCCGCTTCCCCGTCCTCAGCCGATGCCCGACCCGCCGCCGGACGAAGAACCGATTAAAATGTCGCATCAAACGCCCGGATCTGCGAGGATACGCGCCTGCTGA |
Sequence | MSCLLTLLYLHSSLSDPIPTDPVPIPEPLPRPQPMPDPPPDEEPIKMSHQTPGSARIRAC |
Source of smORF | Ribo-seq |
Function | INDUCTION: Expressed during stationary phase (at protein level) Pubmed:29645342 |
Pubmed ID | 28122954 |
Domain | |
Functional Category | Gene Ontology/Expression based functional assignment |
Uniprot ID | P0DPO3 |
ORF Length (Amino Acid) | 60 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1749684 | 1749866 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1449909 | 1450082 | + | NZ_AP014857.1 | Escherichia albertii |
3 | 4163322 | 4163504 | - | NZ_CP053416.1 | Salmonella bongori |
4 | 2527490 | 2527672 | - | NZ_AP022508.1 | Enterobacter bugandensis |
5 | 2741750 | 2741932 | - | NZ_CP043318.1 | Enterobacter chengduensis |
6 | 2491865 | 2492047 | - | NZ_CP027986.1 | Enterobacter sichuanensis |
7 | 2482838 | 2483020 | - | NZ_CP017184.1 | Enterobacter roggenkampii |
8 | 4755219 | 4755401 | + | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
9 | 2510106 | 2510288 | - | NC_015968.1 | Enterobacter soli |
10 | 1369890 | 1370072 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
11 | 2512118 | 2512300 | - | NZ_CP009756.1 | Enterobacter cloacae |
12 | 1716358 | 1716540 | - | NZ_CP017279.1 | Enterobacter ludwigii |
13 | 1344754 | 1344936 | - | NZ_CP023529.1 | Lelliottia amnigena |
14 | 1075484 | 1075666 | - | NZ_CP038469.1 | Citrobacter tructae |
15 | 4746567 | 4746734 | + | NZ_CP044098.1 | Citrobacter portucalensis |
16 | 313417 | 313584 | - | NZ_CP033744.1 | Citrobacter freundii |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01171.22 | 1.0 | 16 | 1447.5 | opposite-strand | PP-loop family |
2 | PF00270.31 | 1.0 | 16 | 29 | same-strand | DEAD/DEAH box helicase |
3 | PF00271.33 | 1.0 | 16 | 28.5 | same-strand | Helicase conserved C-terminal domain |
4 | PF03880.17 | 1.0 | 16 | 28.5 | same-strand | DbpA RNA binding domain |
5 | PF04851.17 | 1.0 | 16 | 28.5 | same-strand | Type III restriction enzyme, res subunit |
6 | PF01544.20 | 1.0 | 16 | 275.0 | same-strand | CorA-like Mg2+ transporter protein |
7 | PF00015.23 | 0.88 | 14 | 1412.5 | same-strand | Methyl-accepting chemotaxis protein (MCP) signalling domain |
8 | PF00990.23 | 0.88 | 14 | 3068 | opposite-strand | Diguanylate cyclase, GGDEF domain |
9 | PF08448.12 | 0.88 | 14 | 5223.0 | opposite-strand | PAS fold |
10 | PF13426.9 | 0.88 | 14 | 5223.0 | opposite-strand | PAS domain |
11 | PF00563.22 | 0.75 | 12 | 3005.5 | opposite-strand | EAL domain |
12 | PF03707.18 | 0.75 | 12 | 3005.5 | opposite-strand | Bacterial signalling protein N terminal repeat |