Result : EXP00497

Protein Information

• Protein name: EXP00497
• NCBI Accession ID: NC_016856.1
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
• Left: 1344999
• Right: 1345172
• Strand: -
• Nucleotide Sequence: ATGGTCGCCAAAAATAAAATTCACGGTCGTCGTATTCGTCAGTCTCTGCAACAGTTACATTATCGTTGTCTTTTTCAGCAACTGGCGGTAAGACCACCAGGAACAAAATATGTTTCAGTCACCGCTGAAACAAAAAACTGGCTTATTCATCTTGTGACTTCAGAGGGCCGTTAG
• Sequence: MVAKNKIHGRRIRQSLQQLHYRCLFQQLAVRPPGTKYVSVTAETKNWLIHLVTSEGR
• Source of smORF: Ribo-seq
• Pubmed ID: 28122954
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 57

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1335014	1335187	-	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	3740439	3740612	-	NZ_CP053416.1	Salmonella bongori

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003197.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF06316.13	1.0	2	2184.5	opposite-strand	Enterobacterial Ail/Lom protein
2	PF13505.8	1.0	2	2184.5	opposite-strand	Outer membrane protein beta-barrel domain
3	PF09864.11	1.0	2	626.5	same-strand	Membrane-bound lysozyme-inhibitor of c-type lysozyme
4	PF00011.23	1.0	2	314.0	opposite-strand	Hsp20/alpha crystallin family
5	PF17886.3	1.0	2	314.0	opposite-strand	HSP20-like domain found in ArsA
6	PF01292.22	1.0	2	1765.5	same-strand	Prokaryotic cytochrome b561
7	PF13146.8	1.0	2	2442.5	same-strand	TRL-like protein family
8	PF00496.24	1.0	2	3434.0	opposite-strand	Bacterial extracellular solute-binding proteins, family 5 Middle