Result : B1LBA0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | CP000969.1 |
| Organism | Thermotoga sp. (strain RQ2) |
| Left | 1285180 |
| Right | 1285377 |
| Strand | + |
| Nucleotide Sequence | ATGCCGAAGGTGAAGACAAACAGAAGTGCCGCGAAAAGATTCAGGATAACAAAGAACGGTAAGATAATGAGAAATCACGCTTACAGAAGTCATAAAACGGGAAAGAAAAGAAGAAATGCCCTCAGAGCGCTCAGAAAGAAAGACGTGGTTTCCAGTGCAGATAAAAACAGAGTTCTCAGACTTCTTGGAAAAAAGTGA |
| Sequence | MPKVKTNRSAAKRFRITKNGKIMRNHAYRSHKTGKKRRNALRALRKKDVVSSADKNRVLRLLGKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B1LBA0 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 129
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1233780 | 1233977 | - | NC_023151.1 | Thermotoga maritima MSB8 |
| 2 | 1243326 | 1243523 | - | NC_013642.1 | Thermotoga naphthophila RKU-10 |
| 3 | 1223037 | 1223234 | - | NC_009486.1 | Thermotoga petrophila RKU-1 |
| 4 | 868478 | 868675 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 5 | 320866 | 321054 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 6 | 255977 | 256165 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 7 | 962042 | 962230 | + | NZ_CP007389.1 | Thermosipho melanesiensis |
| 8 | 724819 | 725007 | + | NC_009718.1 | Fervidobacterium nodosum Rt17-B1 |
| 9 | 1224852 | 1225040 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 10 | 1847194 | 1847379 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 11 | 1961243 | 1961425 | + | NC_015707.1 | Pseudothermotoga thermarum DSM 5069 |
| 12 | 691376 | 691561 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 13 | 1410137 | 1410325 | + | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 14 | 1422494 | 1422682 | + | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 15 | 1973595 | 1973792 | + | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 16 | 456857 | 457054 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 17 | 2385893 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 18 | 3167593 | 3167787 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 19 | 2576117 | 2576308 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 20 | 964851 | 965045 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 21 | 3629665 | 3629865 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 22 | 3138667 | 3138867 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 23 | 2519482 | 2519676 | - | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 24 | 728029 | 728226 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 25 | 2831948 | 2832148 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 26 | 3604213 | 3604410 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 27 | 74509 | 74703 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 28 | 4814991 | 4815188 | + | NZ_CP042435.1 | Panacibacter ginsenosidivorans |
| 29 | 1541084 | 1541278 | + | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 30 | 1057620 | 1057820 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 31 | 3088270 | 3088464 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 32 | 1441163 | 1441357 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 33 | 795134 | 795334 | + | NZ_CP040336.1 | Bacillus luti |
| 34 | 4380540 | 4380740 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 35 | 4404108 | 4404308 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 36 | 4539900 | 4540100 | - | NC_011725.1 | Bacillus cereus B4264 |
| 37 | 3051709 | 3051906 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 38 | 2110139 | 2110336 | - | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 39 | 2399462 | 2399656 | + | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 40 | 1668787 | 1668984 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 41 | 1047425 | 1047622 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 42 | 3321811 | 3322011 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 43 | 937213 | 937410 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 44 | 1212643 | 1212843 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 45 | 3659251 | 3659451 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 46 | 115547 | 115744 | + | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 47 | 2473329 | 2473529 | - | NZ_CP012024.1 | Bacillus smithii |
| 48 | 537142 | 537339 | + | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 49 | 1755209 | 1755403 | + | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 50 | 4574651 | 4574851 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 51 | 2213942 | 2214139 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 52 | 644290 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 53 | 1591668 | 1591865 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 54 | 706893 | 707075 | + | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 55 | 726666 | 726857 | + | NC_015389.1 | Coriobacterium glomerans PW2 |
| 56 | 1190209 | 1190409 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 57 | 887009 | 887200 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 58 | 305602 | 305799 | + | NZ_CP011390.1 | Flavisolibacter tropicus |
| 59 | 2468582 | 2468779 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 60 | 2354826 | 2355023 | - | NZ_CP036259.1 | Sporomusa termitida |
| 61 | 1713839 | 1714036 | - | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 62 | 4002272 | 4002466 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 63 | 886073 | 886267 | + | NZ_CP048106.1 | Pontibacter pudoricolor |
| 64 | 59859 | 60056 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 65 | 2831063 | 2831260 | - | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 66 | 1529382 | 1529582 | - | NZ_CP071878.1 | Mucilaginibacter gossypii |
| 67 | 3670410 | 3670607 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 68 | 1688880 | 1689077 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 69 | 1363865 | 1364062 | + | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 70 | 798694 | 798891 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 71 | 3069866 | 3070066 | - | NZ_CP038029.1 | Sphingobacterium psychroaquaticum |
| 72 | 262426 | 262620 | + | NC_011374.1 | Ureaplasma urealyticum serovar 10 str. ATCC 33699 |
| 73 | 2701345 | 2701545 | - | NZ_CP060723.1 | Pedobacter roseus |
| 74 | 1256613 | 1256807 | + | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 75 | 10114624 | 10114821 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 76 | 2454499 | 2454693 | - | NZ_CP037922.1 | Hymenobacter radiodurans |
| 77 | 2098968 | 2099162 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 78 | 4927394 | 4927588 | + | NZ_CP047984.1 | Pontibacter russatus |
| 79 | 1800418 | 1800618 | - | NZ_CP066775.1 | Mucilaginibacter ginkgonis |
| 80 | 2370961 | 2371161 | - | NZ_CP032869.1 | Mucilaginibacter celer |
| 81 | 2327876 | 2328076 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 82 | 2470351 | 2470548 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 83 | 2334840 | 2335040 | - | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 84 | 4380666 | 4380863 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 85 | 38468 | 38662 | + | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 86 | 1306011 | 1306208 | + | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 87 | 10160203 | 10160400 | - | NZ_CP012159.1 | Chondromyces crocatus |
| 88 | 4324289 | 4324483 | - | NZ_CP040106.1 | Echinicola rosea |
| 89 | 701697 | 701903 | - | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 90 | 371264 | 371458 | - | NC_012115.1 | Nautilia profundicola AmH |
| 91 | 1369950 | 1370147 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 92 | 1722512 | 1722703 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 93 | 3903567 | 3903764 | + | NC_014041.1 | Zunongwangia profunda SM-A87 |
| 94 | 1522152 | 1522349 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 95 | 775796 | 775993 | - | NZ_CP070062.1 | Coprococcus comes |
| 96 | 3431004 | 3431204 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 97 | 1310439 | 1310639 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 98 | 9952 | 10146 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 99 | 381375 | 381569 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 100 | 4060179 | 4060373 | + | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 101 | 2244482 | 2244679 | - | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 102 | 3170603 | 3170800 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 103 | 3056681 | 3056878 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 104 | 1215653 | 1215850 | + | NZ_CP046570.1 | Xanthomonas albilineans |
| 105 | 1604616 | 1604813 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 106 | 4179797 | 4179991 | + | NZ_CP014766.1 | Pontibacter akesuensis |
| 107 | 297056 | 297256 | + | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 108 | 2969589 | 2969786 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 109 | 1556875 | 1557072 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 110 | 2163211 | 2163408 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 111 | 1983243 | 1983440 | + | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 112 | 4190247 | 4190444 | + | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 113 | 1968007 | 1968204 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 114 | 2995883 | 2996080 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 115 | 911755 | 911952 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 116 | 274588 | 274794 | + | NZ_CP020921.1 | Thermodesulfobium acidiphilum |
| 117 | 298542 | 298748 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 118 | 2791642 | 2791839 | - | NZ_CP053627.1 | Xylella taiwanensis |
| 119 | 1649982 | 1650173 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 120 | 1591398 | 1591595 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 121 | 1387603 | 1387797 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 122 | 3211173 | 3211370 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 123 | 60718 | 60909 | - | NZ_CP012544.1 | Campylobacter showae |
| 124 | 2509242 | 2509439 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 125 | 1119185 | 1119382 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 126 | 2427264 | 2427455 | - | NZ_CP012543.1 | Campylobacter rectus |
| 127 | 3224245 | 3224442 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 128 | 2980393 | 2980596 | - | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 129 | 1813170 | 1813367 | - | NZ_CP067057.1 | Rahnella aceris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059066.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 0.99 | 128 | 36.0 | same-strand | Ribosomal protein L20 |
| 2 | PF00707.24 | 0.92 | 119 | 30 | same-strand | Translation initiation factor IF-3, C-terminal domain |
| 3 | PF05198.18 | 0.63 | 81 | 29 | same-strand | Translation initiation factor IF-3, N-terminal domain |
| 4 | PF00587.27 | 0.69 | 89 | 835 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 5 | PF03129.22 | 0.69 | 89 | 837.5 | same-strand | Anticodon binding domain |
| 6 | PF07973.16 | 0.68 | 88 | 833.5 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 7 | PF02824.23 | 0.65 | 84 | 837.5 | same-strand | TGS domain |
++ More..