Result : A0Q2Z9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000382.1 |
| Organism | Clostridium novyi (strain NT) |
| Left | 2218898 |
| Right | 2219152 |
| Strand | - |
| Nucleotide Sequence | ATGATAAGTTCACAAGCGTTTGTAGCAGGAATGTGTGCAATAGGAGCTGGATTAGCATCAATTGCATGTATAGGTGGTGGTATTGGAACAGGTAATGCTACAGCTAAAGCAGTAGAAGGAGTTTCAAGACAACCAGAAGCTAGTGGTAAAATATTAAGTACTATGATTATAGGTAGTGCGTTATCAGAAGCAACAGCTATATATGGCTTCTTAATAGCTATATTATTAGTATTAAAAATTGGAAATATAGGTTAA |
| Sequence | MISSQAFVAGMCAIGAGLASIACIGGGIGTGNATAKAVEGVSRQPEASGKILSTMIIGSALSEATAIYGFLIAILLVLKIGNIG |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 17115055 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A0Q2Z9 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2218898 | 2219152 | - | NC_008593.1 | Clostridium novyi NT |
| 2 | 4516472 | 4516693 | - | NZ_CP014176.1 | Clostridium argentinense |
| 3 | 3417701 | 3417967 | - | NZ_CP014176.1 | Clostridium argentinense |
| 4 | 186394 | 186633 | + | NZ_CP028842.1 | Clostridium botulinum |
| 5 | 185559 | 185798 | + | NZ_CP011663.1 | Clostridium sporogenes |
| 6 | 3749867 | 3750079 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 7 | 205497 | 205766 | + | NC_018664.1 | Gottschalkia acidurici 9a |
| 8 | 2429660 | 2429878 | - | NZ_CP016786.1 | Clostridium isatidis |
| 9 | 524876 | 525094 | + | NZ_CP014204.2 | Clostridium baratii |
| 10 | 2225345 | 2225563 | + | NZ_CP023671.1 | Clostridium septicum |
| 11 | 311379 | 311597 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 12 | 2438489 | 2438707 | - | NZ_CP027286.1 | Clostridium chauvoei |
| 13 | 303760 | 304020 | - | NC_014833.1 | Ruminococcus albus 7 = DSM 20455 |
| 14 | 1678831 | 1679115 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 15 | 147250 | 147486 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 16 | 946611 | 946880 | - | NZ_CP068114.1 | Fusobacterium canifelinum |
| 17 | 2112596 | 2112865 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
| 18 | 2258409 | 2258678 | - | NZ_CP013336.1 | Fusobacterium hwasookii ChDC F206 |
| 19 | 832556 | 832825 | - | NZ_LN831027.1 | Fusobacterium nucleatum subsp. polymorphum |
| 20 | 385990 | 386256 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 21 | 230932 | 231198 | + | NZ_CP009687.1 | Clostridium aceticum |
| 22 | 215640 | 215906 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 23 | 935552 | 935812 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 24 | 99226 | 99489 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
| 25 | 495853 | 496116 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
| 26 | 231940 | 232203 | + | NC_014632.1 | Ilyobacter polytropus DSM 2926 |
| 27 | 177150 | 177416 | + | NZ_LT635475.1 | Ezakiella massiliensis |
| 28 | 695921 | 696136 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 29 | 1180347 | 1180610 | + | NZ_CP028103.1 | Fusobacterium varium ATCC 27725 |
| 30 | 1505727 | 1505990 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 31 | 2694048 | 2694254 | + | NZ_CP028105.1 | Fusobacterium ulcerans |
| 32 | 204236 | 204445 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 33 | 2331433 | 2331642 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 34 | 251405 | 251647 | + | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 35 | 880010 | 880264 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 36 | 1991580 | 1991798 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 37 | 2118125 | 2118337 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 38 | 188236 | 188469 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 39 | 52449 | 52682 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 40 | 3950127 | 3950408 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 41 | 260881 | 261108 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 42 | 2566334 | 2566558 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 43 | 1465731 | 1465946 | - | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 44 | 2254520 | 2254774 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 45 | 1297033 | 1297245 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 46 | 2462616 | 2462834 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 47 | 1458055 | 1458270 | + | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 48 | 1988490 | 1988717 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 49 | 1428781 | 1428996 | + | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 50 | 1289338 | 1289553 | - | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 51 | 2000279 | 2000569 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 52 | 855506 | 855721 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 53 | 594393 | 594623 | - | NZ_CP053187.1 | Turicibacter sanguinis |
| 54 | 676150 | 676374 | + | NZ_CP029256.1 | Christensenella minuta |
| 55 | 276017 | 276250 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 56 | 3160039 | 3160263 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 57 | 2666194 | 2666421 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 58 | 2496862 | 2497077 | - | NZ_HG917868.1 | Clostridium bornimense |
| 59 | 2968473 | 2968685 | - | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 60 | 4886285 | 4886509 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 61 | 4886607 | 4886831 | - | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 62 | 4510936 | 4511154 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 63 | 4342894 | 4343151 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 64 | 2943136 | 2943351 | - | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 65 | 3005790 | 3006002 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 66 | 3380435 | 3380650 | - | NZ_CP039126.1 | Blautia producta |
| 67 | 2729512 | 2729724 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 68 | 776821 | 777033 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 69 | 2252925 | 2253137 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 70 | 2456658 | 2456882 | + | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 71 | 3117680 | 3117943 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 72 | 340241 | 340504 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 73 | 210175 | 210399 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 74 | 3156992 | 3157216 | - | NZ_LR699011.1 | Roseburia hominis |
| 75 | 3421478 | 3421732 | - | NZ_LR699011.1 | Roseburia hominis |
| 76 | 467225 | 467437 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
| 77 | 1121403 | 1121648 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 78 | 944391 | 944600 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 79 | 3266064 | 3266279 | - | NZ_CP030775.1 | Clostridium butyricum |
| 80 | 1485699 | 1485917 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 81 | 3082529 | 3082789 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 82 | 687584 | 687799 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 83 | 454921 | 455136 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 84 | 1248315 | 1248527 | + | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 85 | 1342517 | 1342729 | + | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 86 | 1510492 | 1510704 | - | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 87 | 4594468 | 4594728 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 88 | 590138 | 590365 | + | NZ_AP022873.1 | Dissulfurispira thermophila |
| 89 | 2336730 | 2336990 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 90 | 2727253 | 2727492 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 91 | 724203 | 724418 | + | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 92 | 674296 | 674511 | + | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 93 | 301264 | 301482 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008593.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 0.9 | 78 | 1306.0 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 0.94 | 82 | 1291 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 0.91 | 79 | 2654.0 | same-strand | ATP synthase |
| 4 | PF00306.29 | 0.93 | 81 | 1112.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 0.89 | 77 | 557.0 | same-strand | ATP synthase delta (OSCP) subunit |
| 6 | PF00430.20 | 0.95 | 83 | 55.0 | same-strand | ATP synthase B/B' CF(0) |
| 7 | PF00119.22 | 0.94 | 82 | 48 | same-strand | ATP synthase A chain |
++ More..