Result : B1KYF3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Translational regulator CsrA |
| NCBI Accession ID | CP000962.1 |
| Organism | Clostridium botulinum (strain Loch Maree / Type A3) |
| Left | 2947966 |
| Right | 2948184 |
| Strand | - |
| Nucleotide Sequence | ATGCTAGTTATAACTAGAAAAAAAGGAGAGTCTTTTTTAATAGGAGATGATATAGAGATAACTGTAGTTAAATTAGATGATGGTTCTGTAAAATTAGCCATAGATGCCCCTAAAAAATTAACTATACTAAGAAAAGAACTTTATAATGAAGTTCAAGAGGAAAATAAAAAAGCTACTAATTTTAATCCTTCTATTTTAAAAAATATAAAAAGTAAATAA |
| Sequence | MLVITRKKGESFLIGDDIEITVVKLDDGSVKLAIDAPKKLTILRKELYNEVQEENKKATNFNPSILKNIKSK |
| Source of smORF | Swiss-Prot |
| Function | A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW. {ECO:0000255|HAMAP-Rule:MF_00167}. |
| Pubmed ID | 18060065 |
| Domain | CDD:412510 |
| Functional Category | RNA-binding |
| Uniprot ID | B1KYF3 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 65
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3067851 | 3068069 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 2 | 2835938 | 2836156 | - | NZ_CP028842.1 | Clostridium botulinum |
| 3 | 1418612 | 1418827 | + | NZ_CP040924.1 | Clostridium thermarum |
| 4 | 3006553 | 3006771 | - | NZ_CP030775.1 | Clostridium butyricum |
| 5 | 1909569 | 1909784 | + | NZ_CP013019.1 | Clostridium pasteurianum |
| 6 | 601505 | 601720 | - | NZ_CP023671.1 | Clostridium septicum |
| 7 | 1353616 | 1353840 | - | NZ_CP016786.1 | Clostridium isatidis |
| 8 | 4890001 | 4890219 | - | NZ_CP043998.1 | Clostridium diolis |
| 9 | 1466178 | 1466390 | - | NZ_LT906477.1 | Clostridium cochlearium |
| 10 | 4988197 | 4988415 | - | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 11 | 3446304 | 3446522 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 12 | 1981496 | 1981720 | - | NZ_CP032416.1 | Clostridium fermenticellae |
| 13 | 4384755 | 4384973 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 14 | 2703263 | 2703478 | - | NZ_CP014176.1 | Clostridium argentinense |
| 15 | 205032 | 205247 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 16 | 873459 | 873680 | + | NZ_CP020953.1 | Clostridium drakei |
| 17 | 2302840 | 2303061 | - | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 18 | 901641 | 901856 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 19 | 2081831 | 2082058 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 20 | 811796 | 812011 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 21 | 2127170 | 2127385 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 22 | 3313125 | 3313340 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 23 | 1064690 | 1064905 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 24 | 2083195 | 2083416 | - | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 25 | 1086108 | 1086326 | + | NC_008593.1 | Clostridium novyi NT |
| 26 | 5566600 | 5566818 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 27 | 2748682 | 2748894 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 28 | 1835029 | 1835244 | - | NZ_HG917868.1 | Clostridium bornimense |
| 29 | 3138451 | 3138666 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 30 | 1134230 | 1134457 | + | NZ_LR590481.1 | Hathewaya histolytica |
| 31 | 3756421 | 3756633 | - | NZ_CP019870.1 | Clostridioides difficile |
| 32 | 207133 | 207357 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 33 | 190154 | 190378 | + | NZ_CP019401.1 | Planococcus faecalis |
| 34 | 198739 | 198963 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 35 | 178262 | 178486 | + | NZ_CP016540.2 | Planococcus versutus |
| 36 | 187245 | 187469 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 37 | 1572340 | 1572564 | - | NZ_CP013661.2 | Planococcus kocurii |
| 38 | 249184 | 249411 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 39 | 2636505 | 2636720 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 40 | 3589291 | 3589527 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 41 | 1961899 | 1962126 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 42 | 2127145 | 2127378 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 43 | 431457 | 431708 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 44 | 592709 | 592936 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 45 | 4047032 | 4047265 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 46 | 2370805 | 2371041 | - | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 47 | 2189689 | 2189916 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 48 | 262089 | 262334 | + | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 49 | 2465311 | 2465562 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 50 | 476799 | 477020 | - | NC_011653.1 | Thermosipho africanus TCF52B |
| 51 | 434317 | 434550 | - | NC_012115.1 | Nautilia profundicola AmH |
| 52 | 2699914 | 2700138 | - | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 53 | 114616 | 114834 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 54 | 164863 | 165084 | + | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 55 | 217963 | 218190 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 56 | 1959539 | 1959760 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 57 | 1460861 | 1461091 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 58 | 2814492 | 2814719 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 59 | 1755702 | 1755938 | - | NZ_CP011058.1 | Paenibacillus beijingensis |
| 60 | 2503155 | 2503382 | - | NC_015520.1 | Mahella australiensis 50-1 BON |
| 61 | 4012471 | 4012686 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 62 | 203711 | 203932 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 63 | 200237 | 200458 | + | NZ_CP016538.2 | Planococcus maritimus |
| 64 | 3391145 | 3391366 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 65 | 268313 | 268537 | + | NZ_CP009687.1 | Clostridium aceticum |
| 66 | 200091 | 200312 | + | NZ_CP059540.1 | Planococcus maritimus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011663.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07195.14 | 0.69 | 45 | 1267 | same-strand | Flagellar hook-associated protein 2 C-terminus |
| 2 | PF02465.20 | 0.71 | 46 | 1267.0 | same-strand | Flagellar hook-associated protein 2 N-terminus |
| 3 | PF02561.16 | 0.6 | 39 | 764.5 | same-strand | Flagellar protein FliS |
| 4 | PF02623.17 | 0.97 | 63 | 4.0 | same-strand | FliW protein |
| 5 | PF00669.22 | 0.92 | 60 | 492.0 | same-strand | Bacterial flagellin N-terminal helical region |
| 6 | PF00700.23 | 0.78 | 51 | 525.5 | same-strand | Bacterial flagellin C-terminal helical region |
| 7 | PF00460.22 | 0.77 | 50 | 1908 | same-strand | Flagella basal body rod protein |
| 8 | PF05130.14 | 0.75 | 49 | 3602 | same-strand | FlgN protein |
++ More..