Protein Information |
Information Type | Description |
---|---|
Protein name | EXP00479 |
NCBI Accession ID | NC_016856.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
Left | 3965291 |
Right | 3965383 |
Strand | + |
Nucleotide Sequence | ATGATATCGTGGCGAAGCATTATCCGGGGGCGCTGCCCGCAAAATAAACGCTATCTGCGTAATAAGCTTCACCAGGAATTTCTGGCATACTAG |
Sequence | MISWRSIIRGRCPQNKRYLRNKLHQEFLAY |
Source of smORF | Ribo-seq |
Function | |
Pubmed ID | 28122954 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 30 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3951611 | 3951703 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 144667 | 144759 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
3 | 2343279 | 2343359 | + | NZ_CP011078.1 | Yersinia ruckeri |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13310.8 | 1.0 | 3 | 42 | same-strand | Virulence protein RhuM family |