Result : EXP00479
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP00479 |
| NCBI Accession ID | NC_016856.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S |
| Left | 3965291 |
| Right | 3965383 |
| Strand | + |
| Nucleotide Sequence | ATGATATCGTGGCGAAGCATTATCCGGGGGCGCTGCCCGCAAAATAAACGCTATCTGCGTAATAAGCTTCACCAGGAATTTCTGGCATACTAG |
| Sequence | MISWRSIIRGRCPQNKRYLRNKLHQEFLAY |
| Source of smORF | Ribo-seq |
| Function | |
| Pubmed ID | 28122954 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3951611 | 3951703 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 144667 | 144759 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 3 | 2343279 | 2343359 | + | NZ_CP011078.1 | Yersinia ruckeri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13310.8 | 1.0 | 3 | 42 | same-strand | Virulence protein RhuM family |
++ More..